LL-37 amide - Antimicrobial Peptides - AMP
LL-37 is a member of the large cationic family of anti-microbial peptides called cathelicidins which have broad-spectrum anti-microbial activity and are expressed in many species. The only cathelicidin found in humans is LL-37, this is produced in epithelial cells, by proteolytic cleavage from the C-terminal of the hCAP-18 protein. LL-37 can be processed into different forms of anti-microbial peptides. As well as its anti-microbial properties LL-37 also regulates many aspects of the innate immune system and overexpression of LL-37 has been linked to autoimmune diseases such as asthma and psoriasis, making LL-37 the most studied form of the human cathelicidin peptides. More recently, studies have shown that LL-37 binds to SARS-CoV-2 S protein and inhibits binding to its receptor hACE2, which may inhibit viral entry into the cell. LL-37 is upregulated by vitamin D, therefore this may be one mode of action for the positive outcomes seen with vitamin D treatment for Covid-19.
Technical specification
![]() |
Sequence : | H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-NH2 |
![]() |
MW : | |
![]() |
Purity : | > 95% |
![]() |
Counter-Ion : | TFA Salts |
![]() |
Delivery format : | Lyophilized |
Price
| Product | Size | Price € | Price $ |
| CRB1000864-0.5 mg | 0.5 mg | 282€ | 339$ |
| CRB1000864-1 mg | 1 mg | 385€ | 462$ |




