ρ-Da1a (AdTx1) - Ion Channels and Transporters
AdTx1 (rho-Da1a – ρ-Da1a) is a 65 amino-acid peptide originally isolated from the venom of the green mamba, an African snake (Dendroaspis angusticep). AdTx1 is stabilized by four disulfide bridges and belongs to the family of the three-finger-fold peptide. AdTx1 has subnanomolar affinity (K(i)= 0.35 nM) and high specificity for the human alpha(1A)-adrenoceptor subtype and is 1000 times more potent on this subtype than on other adrenoceptor subtypes. AdTx1 is a potent relaxant of smooth muscles.
Technical specification
 |
Sequence : | H-LTCVTSKSIFGITTEDCPDGQNLCFKRRHYVVPKIYDSTRGCAATCPIPENYDSIHCCKTDKCNE-OH (Cys3-Cys24; Cys17-Cys42; Cys46-Cys57; Cys58-Cys63) |
 |
MW : | 7283.29 g/mol |
 |
Purity : | > 95% |
 |
Counter-Ion : | TFA Salts |
 |
Delivery format : | Lyophilized |
Price
| Product | Size | Price € | Price $ |
| ADT001-0.01 mg | 0.01 mg | 121€ | 146$ |
| ADT001-5 x 0.01 mg | 5 x 0.01 mg | 330€ | 396$ |
If you'd like to learn more about this toxin, visit our product page on our Smartox website—Our sister company specializing in the synthesis of complex toxins.
