ω-Hexatoxin-Hv1a - Ion Channels and Transporters
ω-Hexatoxin-Hv1a (ω-HXTX-Hv1a, ω-atracotoxin-Hv1a, ω-ACTX-Hv1a) has been isolated from the venom of Australian funnel web spiders. ω-Hexatoxin-Hv1a has been described to block mid-low- (M-LVA) and high-voltage-activated (HVA) insect calcium channel (Ca(v)) currents.
Technical specification
 |
Sequence : | H-SPTCIPSGQPCPYNENCCSQSCTFKENENGNTVKRCD-OH (Cys4-Cys18; Cys11-Cys22; Cys17-Cys36) |
 |
MW : | 4049.42 g/mol |
 |
Purity : | > 95% |
 |
Counter-Ion : | TFA Salts |
 |
Delivery format : | Lyophilized |
Price
| Product | Size | Price € | Price $ |
| ACT001-0.1 mg | 0.1 mg | 330€ | 396$ |
| ACT001-0.5 mg | 0.5 mg | 1155€ | 1386$ |
If you'd like to learn more about this toxin, visit our product page on our Smartox website—Our sister company specializing in the synthesis of complex toxins.
