ω-Hexatoxin-Hv1a - Ion Channels and Transporters

ω-Hexatoxin-Hv1a (ω-HXTX-Hv1a, ω-atracotoxin-Hv1a, ω-ACTX-Hv1a) has been isolated from the venom of Australian funnel web spiders. ω-Hexatoxin-Hv1a has been described to block mid-low- (M-LVA) and high-voltage-activated (HVA) insect calcium channel (Ca(v)) currents.

 

Technical specification

 KD20 peptide Sequence : H-SPTCIPSGQPCPYNENCCSQSCTFKENENGNTVKRCD-OH (Cys4-Cys18; Cys11-Cys22; Cys17-Cys36)
 KD20 peptide MW : 4049.42 g/mol
 KD20 peptide Purity : > 95%
 KD20 peptide Counter-Ion : TFA Salts
Peptide library synthesis KD20 peptide Delivery format : Lyophilized

Price

 

Product Size Price € Price $
ACT001-0.1 mg 0.1 mg 330€ 396$
ACT001-0.5 mg 0.5 mg 1155€ 1386$

If you'd like to learn more about this toxin, visit our product page on our Smartox website—Our sister company specializing in the synthesis of complex toxins.

For Bulk Orders