ω-Tbo-IT1 - Ion Channels and Transporters

ω-Tbo-IT1 has been isolated from the venom of the Tibellus oblongus spider. ω-Tbo-IT1 is a selective blocker of insects calcium channels. It has been shown that ω-Tbo-IT1 has a potent insect toxicity with LD50 19 μg/g on house fly Musca domestica larvae and LD50 20 μg/g on juvenile Gromphadorhina portentosa cockroaches. Electrophysiological experiments revealed a reversible inhibition of evoked excitatory postsynaptic currents in blow fly Calliphora vicina neuromuscular junctions with an IC50 value 40 ± 10 nM.

 

Technical specification

 KD20 peptide Sequence : H-CASKNERCGNALYGTKGPGCCNGKCICRTVPRKGVNSCRCM-OH (Cys1-Cys21; Cys8-Cys25; Cys20-Cys40)
 KD20 peptide MW : 4331.74 g/mol
 KD20 peptide Purity : > 95%
 KD20 peptide Counter-Ion : TFA Salts
Peptide library synthesis KD20 peptide Delivery format : Lyophilized

Price

 

Product Size Price € Price $
ITO001-0.1 mg 0.1 mg 330€ 396$
ITO001-0.5 mg 0.5 mg 1155€ 1386$

If you'd like to learn more about this toxin, visit our product page on our Smartox website—Our sister company specializing in the synthesis of complex toxins.

For Bulk Orders