ω-agatoxin-IVA - Ion Channels and Transporters

ω-agatoxin-IVA (ω-AGA IVA) is a peptide originally isolated from funnel web-spider venom Agelenopsis aperta. This peptide is a specific blocker of P/Q-type calcium channel (Cav2.1). It has been reported that ω-agatoxin IVA is a potent blocker of voltage-gated calcium channels in insect and vertebrate central neurons. The binding site for ω-agatoxin IVA has been localized in part to the extracellular S3–S4 loop in repeat IV of the α-1A Ca2+ channels, which is proximal to the S4 sensor domain. This is coherent with its functional effect (no pore-blocking activity, but gating modifier by a shift of channel activation towards more depolarized potentials). This makes this toxin a voltage-dependent blocker of P/Q calcium channels.

 

Technical specification

 KD20 peptide Sequence : H-KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA-OH (Cys4-Cys20; Cys12-Cys25; Cys19-Cys36; Cys27-Cys34)
 KD20 peptide MW : 5202.48 g/mol
 KD20 peptide Purity : > 95%
 KD20 peptide Counter-Ion : TFA Salts
Peptide library synthesis KD20 peptide Delivery format : Lyophilized

Price

 

Product Size Price € Price $
11AGA001-0.1 mg 0.1 mg 187€ 225$
11AGA001-0.5 mg 0.5 mg 561€ 674$
11AGA001-1 mg 1 mg 957€ 1149$

If you'd like to learn more about this toxin, visit our product page on our Smartox website—Our sister company specializing in the synthesis of complex toxins.

For Bulk Orders