ω-Tbo-IT1 - Ion Channels and Transporters
ω-Tbo-IT1 has been isolated from the venom of the Tibellus oblongus spider. ω-Tbo-IT1 is a selective blocker of insects calcium channels. It has been shown that ω-Tbo-IT1 has a potent insect toxicity with LD50 19 μg/g on house fly Musca domestica larvae and LD50 20 μg/g on juvenile Gromphadorhina portentosa cockroaches. Electrophysiological experiments revealed a reversible inhibition of evoked excitatory postsynaptic currents in blow fly Calliphora vicina neuromuscular junctions with an IC50 value 40 ± 10 nM.
Technical specification
 |
Sequence : | H-CASKNERCGNALYGTKGPGCCNGKCICRTVPRKGVNSCRCM-OH (Cys1-Cys21; Cys8-Cys25; Cys20-Cys40) |
 |
MW : | 4331.74 g/mol |
 |
Purity : | > 95% |
 |
Counter-Ion : | TFA Salts |
 |
Delivery format : | Lyophilized |
Price
| Product | Size | Price € | Price $ |
| ITO001-0.1 mg | 0.1 mg | 330€ | 396$ |
| ITO001-0.5 mg | 0.5 mg | 1155€ | 1386$ |
If you'd like to learn more about this toxin, visit our product page on our Smartox website—Our sister company specializing in the synthesis of complex toxins.
