ADWX-1 - Ion Channels and Transporters

ADWX-1 is an optimised synthetic analog of the scorpion peptide BmKTx. ADWX-1 is known to block voltage-gated Kv1.3 channel with a high affinity (IC50 = 1.89 pM) and selectivity (340 fold greater affinity than for voltage-dependent ). ADWX-1 inhibits CD4+ CCR7– T-cell proliferation. ADWX-1 is an interesting therapeutic candidate to treat auto-immune disorders such as multiple sclerosis, type-1 diabetes, rheumatoid arthritis and psoriasis. This peptide is a valuable tool for studying the structure-function of Kv1.3 channel and auto-immunity pathways

 

Technical specification

 KD20 peptide Sequence : H-VGINVKCKHSRQCLKPCKDAGMRFGKCTNGKCHCTPK-OH (Cys7-Cys27; Cys13-Cys32; Cys17-Cys34)
 KD20 peptide MW : 1777.05 g/mol
 KD20 peptide Purity : > 95%
 KD20 peptide Counter-Ion : TFA Salts
Peptide library synthesis KD20 peptide Delivery format : Lyophilized

Price

 

Product Size Price € Price $
13ADW001-0.1 mg 0.1 mg 198€ 238$
13ADW001-0.5 mg 0.5 mg 578€ 694$
13ADW001-1 mg 1 mg 985€ 1182$

If you'd like to learn more about this toxin, visit our product page on our Smartox website—Our sister company specializing in the synthesis of complex toxins.

For Bulk Orders