ADWX-1 - Ion Channels and Transporters
ADWX-1 is an optimised synthetic analog of the scorpion peptide BmKTx. ADWX-1 is known to block voltage-gated Kv1.3 channel with a high affinity (IC50 = 1.89 pM) and selectivity (340 fold greater affinity than for voltage-dependent ). ADWX-1 inhibits CD4+ CCR7– T-cell proliferation. ADWX-1 is an interesting therapeutic candidate to treat auto-immune disorders such as multiple sclerosis, type-1 diabetes, rheumatoid arthritis and psoriasis. This peptide is a valuable tool for studying the structure-function of Kv1.3 channel and auto-immunity pathways
Technical specification
 |
Sequence : | H-VGINVKCKHSRQCLKPCKDAGMRFGKCTNGKCHCTPK-OH (Cys7-Cys27; Cys13-Cys32; Cys17-Cys34) |
 |
MW : | 1777.05 g/mol |
 |
Purity : | > 95% |
 |
Counter-Ion : | TFA Salts |
 |
Delivery format : | Lyophilized |
Price
| Product | Size | Price € | Price $ |
| 13ADW001-0.1 mg | 0.1 mg | 198€ | 238$ |
| 13ADW001-0.5 mg | 0.5 mg | 578€ | 694$ |
| 13ADW001-1 mg | 1 mg | 985€ | 1182$ |
If you'd like to learn more about this toxin, visit our product page on our Smartox website—Our sister company specializing in the synthesis of complex toxins.
