ATX-II – Ion Channels and Transporters

ATX-II was originally discovered in 1976 by extraction from the tentacles of Anemonia sulcata (Bergman et al., 1976). At that time, it was already discovered that it has activity on voltage-dependent Na+ channels from the frog Rana esculenta by slowing the rate of inactivation. Later, it was found that the purified toxin has a positive inotropic effect on isolated guinea pig atria linked to delayed inactivation of the Na+ channel (Alsen et al., 1982). ATX-II acts as a late inward Na+ current inducer in the heart that produces atrial arrhythmias, partly because it also promotes Ca2+/calmodulin-dependent protein kinase activation and concomitant Nav1.5 channel phosphorylation and further activation (Liang et al., 2016). Because late inward Na+ current is difficult to witness, but is a risk factor for the induction of cardiac arrhythmias, it is now mandatory for the FDA that all drugs to be approved should lack effect on the ATX-II-induced late inward Nav1.5 Na+ current. ATX-II is a site 3 toxin and affects domain IV voltage-sensor movement. ATX-II is a carboxylated 47 amino acid peptides with 3 disulfide bridges and of 4934.7 Da molecular weight, recently produced by Smartox Biotechnology in its synthetic form.

 

Technical specification

 KD20 peptide Sequence : H-GVPCLCDSDGPSVRGNTLSGIIWLAGCPSGWHNCKKHGPTIGWCCKQ-OH ( Cys4-Cys44; Cys6-Cys34; Cys27-Cys45)
 KD20 peptide MW : 2565.36 g/mol
 KD20 peptide Purity : > 95%
 KD20 peptide Counter-Ion : TFA Salts
Peptide library synthesis KD20 peptide Delivery format : Lyophilized

Price

 

Product Size Price € Price $
ATX002-0.01 mg 0.01 mg 110€ 132$
ATX002-0.1 mg 0.1 mg 308€ 370$
ATX002-0.5 mg 0.5 mg 1078€ 1294$
ATX002-1 mg 1 mg 1705€ 2046$

If you’d like to learn more about this toxin, visit our product page on our Smartox website—Our sister company specializing in the synthesis of complex toxins.

For Bulk Orders