BDS-I - Ion Channels and Transporters
BDS-1 is a 43 amino acid peptide which was originally isolated from the venom of the sea anemona Anemonia Viridis. BDS-1 was originally described as a highly selective blocker of the rapidly inactivating voltage-gated potassium channel Kv3.4/ KCNC4, a potential therapeutic target for major CNS disorders (Alzheimer and Parkinson diseases). The toxin acts as gating modifiers, mainly by shifting the voltage-dependence of activation. Channel block occurs with high affinity (IC50 of 43 nM) and is rapid and reversible. BDS-1 also blocks the Kv3.1 and Kv3.2 channels albeit with a lower affinity (>200 nM). Finally, in a more recent study, it was demonstrated that BDS-1 is a selective gating activator of the Nav1.7 channel subtype, an important target for pain management. On the human isoform, modulation is witnessed by a drastic slowing of channel inactivation which occurs with an IC50 of 3 nM.
Technical specification
![]() |
Sequence : | H-AAPCFCSGKPGRGDLWILRGTCPGGYGYTSNCYKWPNICCYPH-OH (Cys4-Cys39; Cys6-Cys32; Cys22-Cys40) |
![]() |
MW : | 2746.8 g/mol |
![]() |
Purity : | > 95% |
![]() |
Counter-Ion : | TFA Salts |
![]() |
Delivery format : | Lyophilized |
Price
| Product | Size | Price € | Price $ |
| BDS001-0.1 mg | 0.1 mg | 253€ | 304$ |
| BDS001-0.5 mg | 0.5 mg | 737€ | 885$ |
| BDS001-5 x 0.01 mg | 5 x 0.01 mg | 220€ | 264$ |
If you'd like to learn more about this toxin, visit our product page on our Smartox website—Our sister company specializing in the synthesis of complex toxins.




