Cecropin-B - Other Categories
Cecropins are a lytic peptide family, originally isolated from Hyalophora cecropia. Cecropin-B is a cationic helical peptide that can form pores, this is believed to be the reason for its such potent lytic activity. Cecropin-B has been shown to be effective against both Gram-positive and Gram-negative bacteria plus numerous cancer cell lines including multidrug-resistant types. The ability to insert into the cell membrane and lead to pore formation is attributed to the amphipathic groups present creating amphipathic regions. The effectiveness of cecropin-B on cancer cells has led to further use of the peptide as a model for potential new anticancer drugs including cyclic cationic forms.
Technical specification
![]() |
Sequence : | H-KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2 |
![]() |
MW : | 3.832.3 g/mol |
![]() |
Purity : | > 95% |
![]() |
Counter-Ion : | TFA Salts |
![]() |
Delivery format : | Lyophilized |
Price
| Product | Size | Price € | Price $ |
| CRB1001130-0.5 mg | 0.5 mg | 282€ | 339$ |
| CRB1001130-1 mg | 1 mg | 385€ | 462$ |




