Cecropin-B - Other Categories

Cecropins are a lytic peptide family, originally isolated from Hyalophora cecropia. Cecropin-B is a cationic helical peptide that can form pores, this is believed to be the reason for its such potent lytic activity. Cecropin-B has been shown to be effective against both Gram-positive and Gram-negative bacteria plus numerous cancer cell lines including multidrug-resistant types. The ability to insert into the cell membrane and lead to pore formation is attributed to the amphipathic groups present creating amphipathic regions. The effectiveness of cecropin-B on cancer cells has led to further use of the peptide as a model for potential new anticancer drugs including cyclic cationic forms.

 

Technical specification

 KD20 peptide Sequence : H-KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2
 KD20 peptide MW : 3.832.3 g/mol
 KD20 peptide Purity : > 95%
 KD20 peptide Counter-Ion : TFA Salts
Peptide library synthesis KD20 peptide Delivery format : Lyophilized

Price

 

Product Size Price € Price $
CRB1001130-0.5 mg 0.5 mg 282€ 339$
CRB1001130-1 mg 1 mg 385€ 462$

For Bulk Orders