Echistatin α1 isoform - Ion Channels and Transporters
Echistatin was originally purified from the venom of the viper Echis carinatus. Echistatin is a cyclic RGD peptide that inhibits platelet aggregation by inhibiting the glycoprotein IIb/IIIa complex receptor. Echistatin is a potent disintegrin that antagonize αVβ3 integrin and has been described to inhibit cell proliferation, migration, invasion, and adhesion of αVβ3 expressing cells.
Technical specification
 |
Sequence : | H-ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT-OH (Cys2-Cys11; Cys7-Cys32; Cys8-Cys37; Cys20-Cys39) |
 |
MW : | 5417.05 g/mol |
 |
Purity : | > 95% |
 |
Counter-Ion : | TFA Salts |
 |
Delivery format : | Lyophilized |
Price
| Product | Size | Price € | Price $ |
| ECH001-0.1 mg | 0.1 mg | 231€ | 278$ |
| ECH001-0.5 mg | 0.5 mg | 704€ | 845$ |
If you'd like to learn more about this toxin, visit our product page on our Smartox website—Our sister company specializing in the synthesis of complex toxins.
