Echistatin α1 isoform - Ion Channels and Transporters

Echistatin was originally purified from the venom of the viper Echis carinatus. Echistatin is a cyclic RGD peptide that inhibits platelet aggregation by inhibiting the glycoprotein IIb/IIIa complex receptor. Echistatin is a potent disintegrin that antagonize αVβ3 integrin and has been described to inhibit cell proliferation, migration, invasion, and adhesion of αVβ3 expressing cells.

 

Technical specification

 KD20 peptide Sequence : H-ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT-OH (Cys2-Cys11; Cys7-Cys32; Cys8-Cys37; Cys20-Cys39)
 KD20 peptide MW : 5417.05 g/mol
 KD20 peptide Purity : > 95%
 KD20 peptide Counter-Ion : TFA Salts
Peptide library synthesis KD20 peptide Delivery format : Lyophilized

Price

 

Product Size Price € Price $
ECH001-0.1 mg 0.1 mg 231€ 278$
ECH001-0.5 mg 0.5 mg 704€ 845$

If you'd like to learn more about this toxin, visit our product page on our Smartox website—Our sister company specializing in the synthesis of complex toxins.

For Bulk Orders