GLP-1 (1-37) - Hormones

Glucagon-like peptide (GLP) 1 is a post-translationally modified version of proglucagon. GLP-1 (1-37) is a naturally produced analog of GLP-1. Unlike truncated GLP-1, GLP-1 (1-37) does not alter food intake in rat models or pancreatic insulin secretion. GLP-1 (1-37) can induce insulin production in developing adult intestinal cells via upregulation of the ngn3 gene and its downstream targets. This can restore glucose homeostasis when implanted into diabetic mice. GLP-1 (1-37) may offer a  future treatment for diabetes mellitus. GLP-1 (1-37) can also inhibit chemokine-induced migration of human CD4-positive lymphocytes, an early step in atherogenesis. This raises the possibility that GLP-1 (1-37) is part of a novel mechanism to modulate vascular disease.

 

Technical specification

 KD20 peptide Sequence : H-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OH
 KD20 peptide MW : 4.167 g/mol
 KD20 peptide Purity : > 95%
 KD20 peptide Counter-Ion : TFA Salts
Peptide library synthesis KD20 peptide Delivery format : Lyophilized

Price

 

Product Size Price € Price $
CRB1001037-0.5 mg 0.5 mg 193€ 232$
CRB1001037-1 mg 1 mg 385€ 462$

For Bulk Orders