GLP-1 (7-36) [Cys(Sulfocyanine5)] - Fluorescent Peptides
The native form of GLP-1 in humans is the GLP-1 (7-36) amide. GLP-1 (7-36) amide is highly unstable (half-life <-2 minutes) due to proteolytic degradation by the serine protease, dipeptidyl peptidase-IV (DPP-IV). DPP-IV cleaves the N-terminal histidine and alanine residues from GLP-1 to generate two equipotent forms: GLP-1 (9-37) and GLP-1 (9-36) amide. This degradation mitigates against the therapeutic use of GLP-1 itself, therefore DPP-IV-resistant peptide analogues have been developed and licensed for clinical use. Contains a sulfo-Cyanine5 fluorescent dye, an analogy of Cy5® and one of the most popular fluorophores. Sulfo-Cyanine5 is a red emitting fluorescent dye which is highly hydrophilic and water-soluble. Compatible with various equipment such as plate readers, microscopes, and imagers.
Technical specification
![]() |
Sequence : | H-HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR(C/Sulfocyanine5)-NH2 |
![]() |
MW : | 4.162.9 g/mol |
![]() |
Purity : | > 95% |
![]() |
Counter-Ion : | TFA Salts |
![]() |
Delivery format : | Lyophilized |
Price
| Product | Size | Price € | Price $ |
| CRB1100802-0.1 mg | 0.1 mg | 385€ | 462$ |
| CRB1100802-0.5 mg | 0.5 mg | 770€ | 924$ |
| CRB1100802-1 mg | 1 mg | 963€ | 1156$ |




