Hainantoxin-IV - Ion Channels and Transporters

Hainantoxin-IV (HNTX-IV) is a peptide that was originally isolated from the venom of the Chinese bird spider Ornithoctonus hainana Liang (Selenocosmia hainana Liang). It has been reported that this peptide is a potent antagonist of tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels (VGSCs). Hainantoxin-IV binds to TTX-S with an IC50value of 34 nM in adult rat dorsal root ganglion (DRG) neurons. Tetrodotoxin-resistant (TTX-R) voltage-gated sodium channels are not affected by Hainantoxin-IV. It probably interacts with the site 1 through a mechanism quite similar to that of TTX without affecting the activation and inactivation kinetics.

 

Technical specification

 KD20 peptide Sequence : H-ECLGFGKGCNPSNDQCCKSSNLVCSRKHRWCKYEI-NH2 (Cys2-Cys17; Cys9-Cys24; ; Cys16-Cys31)
 KD20 peptide MW : 3987.6 g/mol
 KD20 peptide Purity : > 95%
 KD20 peptide Counter-Ion : TFA Salts
Peptide library synthesis KD20 peptide Delivery format : Lyophilized

Price

 

Product Size Price € Price $
12HTX001-0.1 mg 0.1 mg 220€ 264$
12HTX001-0.5 mg 0.5 mg 660€ 792$
12HTX001-1 mg 1 mg 1045€ 1254$

If you'd like to learn more about this toxin, visit our product page on our Smartox website—Our sister company specializing in the synthesis of complex toxins.

For Bulk Orders