Hainantoxin-IV - Ion Channels and Transporters
Hainantoxin-IV (HNTX-IV) is a peptide that was originally isolated from the venom of the Chinese bird spider Ornithoctonus hainana Liang (Selenocosmia hainana Liang). It has been reported that this peptide is a potent antagonist of tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels (VGSCs). Hainantoxin-IV binds to TTX-S with an IC50value of 34 nM in adult rat dorsal root ganglion (DRG) neurons. Tetrodotoxin-resistant (TTX-R) voltage-gated sodium channels are not affected by Hainantoxin-IV. It probably interacts with the site 1 through a mechanism quite similar to that of TTX without affecting the activation and inactivation kinetics.
Technical specification
 |
Sequence : | H-ECLGFGKGCNPSNDQCCKSSNLVCSRKHRWCKYEI-NH2 (Cys2-Cys17; Cys9-Cys24; ; Cys16-Cys31) |
 |
MW : | 3987.6 g/mol |
 |
Purity : | > 95% |
 |
Counter-Ion : | TFA Salts |
 |
Delivery format : | Lyophilized |
Price
| Product | Size | Price € | Price $ |
| 12HTX001-0.1 mg | 0.1 mg | 220€ | 264$ |
| 12HTX001-0.5 mg | 0.5 mg | 660€ | 792$ |
| 12HTX001-1 mg | 1 mg | 1045€ | 1254$ |
If you'd like to learn more about this toxin, visit our product page on our Smartox website—Our sister company specializing in the synthesis of complex toxins.
