Huwentoxin-XVI - Ion Channels and Transporters
Huwentoxin-XVI is a 39 amino acids peptide that was discovered from the venom of the Chinese tarantula Ornithoctonus huwena. Huwentoxin-XVI was shown to be a potent blocker of HVA N-type calcium channels with an IC50 value of 60 nM in rat DRG. The blocking effect appears to be similar to that of ω-conotoxin-GVIA and ω-conotoxin-MVIIA. Neverthelss, Huwentoxin-XVI differs from GVIA and MVIIA thanks to its greater reversibility and its higher selectivity for N-type over P/Q type than MVIIA.
Technical specification
 |
Sequence : | H-CIGEGVPCDENDPRCCSGLVCLKPTLHGIWYKSYYCYKK-OH (Cys1-Cys16; Cys8-Cys21; Cys15-Cys36) |
 |
MW : | 4437.11 g/mol |
 |
Purity : | > 95% |
 |
Counter-Ion : | TFA Salts |
 |
Delivery format : | Lyophilized |
Price
| Product | Size | Price € | Price $ |
| HWT016-0.1 mg | 0.1 mg | 198€ | 238$ |
| HWT016-0.5 mg | 0.5 mg | 578€ | 694$ |
| HWT016-1 mg | 1 mg | 985€ | 1182$ |
If you'd like to learn more about this toxin, visit our product page on our Smartox website—Our sister company specializing in the synthesis of complex toxins.
