Kaliotoxin-1 - Ion Channels and Transporters
Kaliotoxin-1 (KTX1) has been isolated from the venom of the Scorpion Androctonus mauretanicus mauretanicus. Kaliotoxin-1 shows a high structural affinity with Iberiotoxin and Charybdotoxin that inhibit KCa2+ channels activity. According to several studies, it appears that Kaliotoxin-1 has a weak inhibitory effect on KCa2+ channels, but it is a potent and selective inhibitor of voltage-activated potassium channel (Kv1.1, Kv1.2, Kv1.3).
Technical specification
 |
Sequence : | H-GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK-OH (Cys8-Cys28; Cys14-Cys33; Cys18-Cys35) |
 |
MW : | 4149.89 g/mol |
 |
Purity : | > 95% |
 |
Counter-Ion : | TFA Salts |
 |
Delivery format : | Lyophilized |
Price
| Product | Size | Price € | Price $ |
| 08KTX002-0.1 mg | 0.1 mg | 165€ | 198$ |
| 08KTX002-0.5 mg | 0.5 mg | 413€ | 496$ |
| 08KTX002-1 mg | 1 mg | 704€ | 845$ |
If you'd like to learn more about this toxin, visit our product page on our Smartox website—Our sister company specializing in the synthesis of complex toxins.
