Margatoxin - Ion Channels and Transporters
Margatoxin (MgTx) is a component of the venom of Scorpio Centruroides margaritatus. Margatoxin preferentially inhibits voltage-dependent potassium channels Kv1.3 with an IC50 value around 50 pM (20 fold more potent than Charybdotoxin) and irreversibly inhibits the proliferation response of human T-cells at 20 µM concentration. Margatoxin is known to be less potent on Kv1.3 expressed in Xenopus Oocytes (IC50 around 1 nM). Margatoxin was also described to be a potent inhibitor of human vascular smooth muscle cell migration with an IC50 of 85 pM.
Technical specification
 |
Sequence : | H-TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH-OH (Cys7-Cys29; Cys13-Cys34; Cys17-Cys36) |
 |
MW : | 4179.02 g/mol |
 |
Purity : | > 95% |
 |
Counter-Ion : | TFA Salts |
 |
Delivery format : | Lyophilized |
Price
| Product | Size | Price € | Price $ |
| 08MAG001-0.1 mg | 0.1 mg | 149€ | 179$ |
| 08MAG001-0.5 mg | 0.5 mg | 418€ | 502$ |
| 08MAG001-1 mg | 1 mg | 583€ | 700$ |
If you'd like to learn more about this toxin, visit our product page on our Smartox website—Our sister company specializing in the synthesis of complex toxins.
