Psalmotoxin-1 (PcTx1) - Ion Channels and Transporters
Psalmotoxin-1 (PcTx1, Pi-theraphotoxin-Pc1a) has been isolated from the venom of the Spider Psalmopoeus cambridgei (Trinidad chevron tarantula). PcTx1 is known to block potently (IC50 = 1 nM) and selectively the H+-gated sodium channel ASIC1a (acid-sensitive ion channel 1a). The blockage is rapid and reversible. PcTx1 can distinguish between the two ASIC1 splice variants ASIC1a and ASIC1b. PcTx1 loses its capacity to block ASIC1a as soon as this subunit is associated with another member of the family (ASIC2a or ASIC3). PcTx1 demonstrates an analgesic effect in acute and neuropathic pain models.
Technical specification
 |
Sequence : | H-EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT-OH (Cys3-Cys18; Cys10-Cys23; Cys17-Cys33) |
 |
MW : | 4689.40 g/mol |
 |
Purity : | > 95% |
 |
Counter-Ion : | TFA Salts |
 |
Delivery format : | Lyophilized |
Price
| Product | Size | Price € | Price $ |
| 13PCT001-0.1 mg | 0.1 mg | 149€ | 179$ |
| 13PCT001-0.5 mg | 0.5 mg | 440€ | 528$ |
| 13PCT001-1 mg | 1 mg | 638€ | 766$ |
If you'd like to learn more about this toxin, visit our product page on our Smartox website—Our sister company specializing in the synthesis of complex toxins.
