Psalmotoxin-1 (PcTx1) – Ion Channels and Transporters

Psalmotoxin-1 (PcTx1, Pi-theraphotoxin-Pc1a) has been isolated from the venom of the Spider Psalmopoeus cambridgei (Trinidad chevron tarantula). PcTx1 is known to block potently (IC50 = 1 nM) and selectively the H+-gated sodium channel ASIC1a (acid-sensitive ion channel 1a). The blockage is rapid and reversible. PcTx1 can distinguish between the two ASIC1 splice variants ASIC1a and ASIC1b. PcTx1 loses its capacity to block ASIC1a as soon as this subunit is associated with another member of the family (ASIC2a or ASIC3). PcTx1 demonstrates an analgesic effect in acute and neuropathic pain models.

 

Technical specification

 KD20 peptide Sequence : H-EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT-OH (Cys3-Cys18; Cys10-Cys23; Cys17-Cys33)
 KD20 peptide MW : 4689.40 g/mol
 KD20 peptide Purity : > 95%
 KD20 peptide Counter-Ion : TFA Salts
Peptide library synthesis KD20 peptide Delivery format : Lyophilized

Price

 

Product Size Price € Price $
13PCT001-0.1 mg 0.1 mg 149€ 179$
13PCT001-0.5 mg 0.5 mg 440€ 528$
13PCT001-1 mg 1 mg 638€ 766$

If you’d like to learn more about this toxin, visit our product page on our Smartox website—Our sister company specializing in the synthesis of complex toxins.

For Bulk Orders