ω-agatoxin-IVA - Ion Channels and Transporters
ω-agatoxin-IVA (ω-AGA IVA) is a peptide originally isolated from funnel web-spider venom Agelenopsis aperta. This peptide is a specific blocker of P/Q-type calcium channel (Cav2.1). It has been reported that ω-agatoxin IVA is a potent blocker of voltage-gated calcium channels in insect and vertebrate central neurons. The binding site for ω-agatoxin IVA has been localized in part to the extracellular S3–S4 loop in repeat IV of the α-1A Ca2+ channels, which is proximal to the S4 sensor domain. This is coherent with its functional effect (no pore-blocking activity, but gating modifier by a shift of channel activation towards more depolarized potentials). This makes this toxin a voltage-dependent blocker of P/Q calcium channels.
Technical specification
 |
Sequence : | H-KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA-OH (Cys4-Cys20; Cys12-Cys25; Cys19-Cys36; Cys27-Cys34) |
 |
MW : | 5202.48 g/mol |
 |
Purity : | > 95% |
 |
Counter-Ion : | TFA Salts |
 |
Delivery format : | Lyophilized |
Price
| Product | Size | Price € | Price $ |
| 11AGA001-0.1 mg | 0.1 mg | 187€ | 225$ |
| 11AGA001-0.5 mg | 0.5 mg | 561€ | 674$ |
| 11AGA001-1 mg | 1 mg | 957€ | 1149$ |
If you'd like to learn more about this toxin, visit our product page on our Smartox website—Our sister company specializing in the synthesis of complex toxins.
