Agitoxin-2 - Ion Channels and Transporters
Agitoxin-2 is a potent and selective blocker of the Shaker type voltage-gated Kv1.3 and Kv1.1 channels. Agitoxin-2 inhibits Kv1.3 with an IC50 value of around 200 pM and Kv1.1 with an IC50 value of around 140 pM. This peptide toxin was originally isolated from the venom of the Israeli scorpion L. quinquestriatus hebraeus.
Technical specification
 |
Sequence : | H-GVPINVSCTGSPQCIKPCKDAGMRFGKCMNRKCHCTPK-OH (Cys8-Cys28; Cys14-Cys33; Cys18-Cys35) |
 |
MW : | 4090.89 g/mol |
 |
Purity : | > 95% |
 |
Counter-Ion : | TFA Salts |
 |
Delivery format : | Lyophilized |
Price
| Product | Size | Price € | Price $ |
| 13AGI002-0.1 mg | 0.1 mg | 165€ | 198$ |
| 13AGI002-0.5 mg | 0.5 mg | 440€ | 528$ |
| 13AGI002-1 mg | 1 mg | 660€ | 792$ |
If you'd like to learn more about this toxin, visit our product page on our Smartox website—Our sister company specializing in the synthesis of complex toxins.
