Agitoxin-2 - Ion Channels and Transporters

Agitoxin-2 is a potent and selective blocker of the Shaker type voltage-gated Kv1.3 and Kv1.1 channels. Agitoxin-2 inhibits Kv1.3 with an IC50 value of around 200 pM and Kv1.1 with an IC50 value of around 140 pM. This peptide toxin was originally isolated from the venom of the Israeli scorpion L. quinquestriatus hebraeus.

 

Technical specification

 KD20 peptide Sequence : H-GVPINVSCTGSPQCIKPCKDAGMRFGKCMNRKCHCTPK-OH (Cys8-Cys28; Cys14-Cys33; Cys18-Cys35)
 KD20 peptide MW : 4090.89 g/mol
 KD20 peptide Purity : > 95%
 KD20 peptide Counter-Ion : TFA Salts
Peptide library synthesis KD20 peptide Delivery format : Lyophilized

Price

 

Product Size Price € Price $
13AGI002-0.1 mg 0.1 mg 165€ 198$
13AGI002-0.5 mg 0.5 mg 440€ 528$
13AGI002-1 mg 1 mg 660€ 792$

If you'd like to learn more about this toxin, visit our product page on our Smartox website—Our sister company specializing in the synthesis of complex toxins.

For Bulk Orders