Huwentoxin-XVI – Ion Channels and Transporters

Huwentoxin-XVI is a 39 amino acids peptide that was discovered from the venom of the Chinese tarantula Ornithoctonus huwena. Huwentoxin-XVI was shown to be a potent blocker of HVA N-type calcium channels with an IC50 value of 60 nM in rat DRG. The blocking effect appears to be similar to that of ω-conotoxin-GVIA and ω-conotoxin-MVIIA. Neverthelss, Huwentoxin-XVI differs from GVIA and MVIIA thanks to its greater reversibility and its higher selectivity for N-type over P/Q type than MVIIA.

 

Technical specification

 KD20 peptide Sequence : H-CIGEGVPCDENDPRCCSGLVCLKPTLHGIWYKSYYCYKK-OH (Cys1-Cys16; Cys8-Cys21; Cys15-Cys36)
 KD20 peptide MW : 4437.11 g/mol
 KD20 peptide Purity : > 95%
 KD20 peptide Counter-Ion : TFA Salts
Peptide library synthesis KD20 peptide Delivery format : Lyophilized

Price

 

Product Size Price € Price $
HWT016-0.1 mg 0.1 mg 198€ 238$
HWT016-0.5 mg 0.5 mg 578€ 694$
HWT016-1 mg 1 mg 985€ 1182$

If you’d like to learn more about this toxin, visit our product page on our Smartox website—Our sister company specializing in the synthesis of complex toxins.

For Bulk Orders