Select Page

MT7 – Muscarinic Toxin 7 - Ion Channels and Transporters

Muscarinic toxin 7 (MT7 – m1-toxin 1) has been isolated from the venom of the green mamba (Dendroaspis Angusticeps). MT7 potently blocks M1-subtype of muscarinic acetylcholine receptors at a subnanomolar affintiy. Muscarinic acetylcholine receptors are G-protein coupled receptors that mediate the metabotropic effects of acetylcholine. M1-type muscarinic acetylcholine receptors are well known therapeutic targets to improve cognitive functions in patients with Alzheimer disease. Contrary to many ligands that target mAChRs (pirenzepine, carbamoylcholine chloride, 4-DAMP or atropine), MT7 is the most selective M1-subtype antagonist as it is about 10,000 times more selective for M1-subtype than other subtypes. MT7 toxin is an ideal tool to identify the muscarinic receptor subtype expression in tissues for example. MT7 toxin belongs to the three finger toxin family such as rho-Da1a.

 

Technical specification

 KD20 peptide Sequence : H-LTCVKSNSIWFPTSEDCPDGQNLCFKRWQYISPRMYDFTRGCAATCPKAEYRDVINCCGTDKCNK-OH (Cys3-Cys24; Cys17-Cys42; Cys46-Cys57; Cys58-Cys63)
 KD20 peptide MW : 7472.43 g/mol
 KD20 peptide Purity : > 95%
 KD20 peptide Counter-Ion : TFA Salts
Peptide library synthesis KD20 peptide Delivery format : Lyophilized

Price

 

Product Size Price € Price $
MTX007-5 x 0.01 mg 5 x 0.01 mg 165€ 198$

If you'd like to learn more about this toxin, visit our product page on our Smartox website—Our sister company specializing in the synthesis of complex toxins.

For Bulk Orders