Cecropin A – Potent antimicrobial and anticancer peptide
Cecropin A is an antimicrobial peptide active against Gram-positive and Gram-negative bacteria.
 Some studies have suggested that cecropin A binds to negatively charged membrane lipids and form a packed layer which permeabilize the membranes and help to kill bacteria. It was shown that cecropin A presents a LC50 of 0.9 µM and a LC90 of 1.7 µM against certain E.Coli strains.
 Besides its well-known antimicrobial properties,studies have demonstrated tumoricidal activity of cecropin A against leukemia,lymphoma,colon carcinoma cell lines and other tumour cell lines.
 Furthermore,Cecropin A has a fungicidal activity. A study has shown that cecropin A reaches a complete lethality at approximately 25 mM for germinating conidia of Aspergillus spp. and a complete lethality for nongerminated and germinated conidia of Fusarium spp. at 1.5 mM.
Technical specification
![]()  | 
Sequence : KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2 | 
![]()  | 
MW : 4 003.88 Da (C184H313N53OS46) | 
![]()  | 
Purity : > 95% | 
![]()  | 
Counter-Ion : TFA Salts (see option TFA removal) | 
![]()  | 
Delivery format : Freeze dried in propylene 2mL microtubes | 
![]()  | 
Other names : Cecropin A (1-33),DTXSID80231193 , 81541-05-1 | 
![]()  | 
Peptide Solubility Guideline | 
![]()  | 
Bulk peptide quantities available | 
Price
| Product catalog | Size | Price € HT | Price $ USD | 
| SB009-1MG | 1 mg | 127 | 158 | 
| SB009-5*1MG | 5*1 mg | 440 | 550 | 
References
1- Lee E,Shin A,Kim Y. Arch Insect Biochem Physiol. (2015)
 
 
Anti-inflammatory Activities of Cecropin A and Its Mechanism of Action
BACKGROUND: Cecropin A is a novel 37-residue cecropin-like antimicrobial peptide isolated from the cecropia moth,Hyalophora cecropia. We have demonstrated that cecropin A is an antibacterial agent and have investigated its mode of action. In this study,we show that cecropin A has potent antimicrobial activity against 2 multidrug resistant organisms-Acinetobacter baumanii and-Pseudomonas aeruginosa.
OBJECTIVE: Potent antimicrobial activity against multidrug resistant organisms-Acinetobacter baumanii and-Pseudomonas aeruginosa
METHOD/RESULTS: Interactions between cecropin A and membrane phospholipids were studied using tryptophan blue shift experiments. Cecropin A has a strong interaction with bacterial cell mimetic membranes. These results imply that cecropin A has selectivity for bacterial cells. To address the potential the rapeutic efficacy of cecropin A,its anti-inflammatory activities and mode of action in mouse macrophage-derived RAW264.7 cells stimulated with lipopolysaccharide (LPS) were examined. Cecropin A suppressed nitrite production,mTNF-α,mIL-1β,mMIP-1,and mMIP-2 cytokine release in LPS-stimulated RAW264.7 cells. Furthermore,cecropin A inhibited intracellular cell signaling via the ERK,JNK,and p38 MAPK pathway,leading to the prevention of COX-2 expression in LPS-stimulated RAW264.7 cells.
CONCLUSION: These results strongly suggest that cecropin A should be investigated as a potential agent for the prevention and treatment of inflammatory diseases.
2- Silvestro,L et al. Antimicrobial agents and chemotherapy vol. 44 ,3 (2000)
 
 
Antibacterial and Antimembrane Activities of Cecropin A in Escherichia coli
BACKGROUND: The ability of cecropin A to permeabilize and depolarize the membranes of Escherichia coli ML-35p bacteria has been compared to its bactericidal activity in an extension of earlier studies performed on synthetic lipid vesicle membranes (L. Silvestro,K. Gupta,J. H. Weiser,and P. H. Axelsen,Biochemistry 36:11452–11460,1997).
OBJECTIVE: Ability of cecropin A to permeabilize and depolarize the membranes of Escherichia coli
METHOD/RESULTS: Our results indicate that differences in the concentration dependences of membrane permeabilization and depolarization seen in synthetic vesicles are not manifested in whole bacteria.
CONCLUSION: The concentration dependences of both phenomena roughly correlate with bactericidal activity,suggesting that the bactericidal mechanism of cecropin A is related to membrane permeabilization.
- Amyloid Peptides
- Acetyl-ccbeta
 - beta-Amyloid (1-11) Human
 - beta-Amyloid (1-12) Human
 - beta-Amyloid (1-14)
 - beta-Amyloid (1-15) human
 - beta-Amyloid (1-16) Human
 - beta-Amyloid (1-17) Human
 - beta-Amyloid (1-28) human
 - beta-Amyloid (1-40) Human
 - beta-Amyloid (1-6)-GGC Human
 - beta-Amyloid (10-20) Human
 - beta-Amyloid (11-20) Human
 - Beta-Amyloid (12-20)
 - beta-Amyloid (35-25)
 - RNase A (77-82) Amyloidogenic peptide
 - SEN 304
 - Tau (195-209) Light
 - Tau Peptide (45-73)
 
 - Antimicrobial Peptides - AMP
- Abaecin
 - Acetyl-Adhesin
 - AcrAP1
 - AcrAP1a
 - AcrAP2
 - AcrAP2a
 - Alloferon 1
 - Alloferon 2
 - Alyteserin-1a
 - Alyteserin-1b
 - Alyteserin-1c
 - Alyteserin-1d
 - Alyteserin-2a
 - Alyteserin-2b
 - Alyteserin-2c
 - Alyteserin-2Mb
 - Anoplin
 - Apidaecin IB
 - B8R (20 – 27)
 - Balteatide
 - BMAP-18
 - BMAP-18 (truncated)
 - Buforin II
 - Cecropin A
 - Codesane
 - CRAMP (1-39)
 - CRAMP (6-39)
 - CRAMP-18
 - Cyclic L27-11
 - Cycloviolacin O2 peptide
 - Epinecidin-1
 - FdM
 - Feleucin-B01
 - Gag (18-26) [Human immunodeficiency virus type 1] acetyl/amide
 - Gag peptide [Simian immunodeficiency virus]
 - Gag protein (181-189) acetyl/amide [Simian immunodeficiency virus]
 - GLK-19
 - hBD-2 peptide – human Beta Defensin 2
 - HEL46-61
 - Hepcidin-25 (LEAP-1 peptide)
 - Histatin-5
 - Histatin-8
 - Hp1404
 - Human Lysozyme (107-115)
 - IDR-1
 - Indolicidin
 - Influenza Virus Nucleoprotein (311 – 325)
 - KDAMP
 - LL-13-37
 - LL-17-29
 - LL-17-32
 - LL-37 amide
 - LL-37 fragment (24-29)
 - LL-37 fragment (30-34)
 - LL-37 fragment (30-37)
 - LL-37 peptide (CAP-18)
 - Macropin 1
 - Macropin 2
 - Magainin II
 - Magainin-1
 - MALT1 substrate
 - Mastoparan
 - Mastoparan peptide
 - mBD3 peptide – mouse Beta Defensin 3
 - MP196
 - N-formylated PSMalpha2
 - N-formylated PSMalpha3
 - P2-Hp-1935
 - PA protein (Influenza A virus)
 - PAF19
 - PAF26
 - Pantinin-1
 - Pantinin-2
 - Pantinin-3
 - Pap12-6
 - Parasin I
 - Pseudin-2
 - Sapecin B
 - SARS-CoV-2 NSP13 (221-235)
 - SARS-CoV-2 NSP13 (226-240)
 - SARS-CoV-2 NSP13 (231-245)
 - SARS-CoV-2 NSP13 (236-250)
 - SARS-CoV-2 NSP13 (241-255)
 - SARS-CoV-2 NSP13 (246-260)
 - SARS-CoV-2 NSP13 (321-335)
 - SARS-CoV-2 NSP13 (326-340)
 - SARS-CoV-2 NSP13 (336-350)
 - SARS-CoV-2 NSP13 (421-435)
 - SARS-CoV-2 NSP13 (426-440)
 - SARS-CoV-2 NSP13 (466-480)
 - SARS-CoV-2 NSP13 (476-490)
 - SARS-CoV-2 NSP13 (551-565)
 - SARS-CoV-2 NSP13 (556-570)
 - SARS-CoV-2 NSP13 (576-590)
 - SARS-CoV-2 NSP13 (581-595)
 - SARS-CoV-2 NSP7 (1-15)
 - SARS-CoV-2 NSP7 (21-35)
 - SARS-CoV-2 NSP7 (31-45)
 - SARS-CoV-2 NSP7 (46-60)
 - SARS-CoV-2 NSP7 (51-65)
 - SARS-CoV-2 NSP7 (6-20)
 - SARS-CoV-2 Nucleoprotein (1-17)
 - SARS-CoV-2 Nucleoprotein (104-121)
 - SARS-CoV-2 Nucleoprotein (126-140)
 - SARS-CoV-2 Nucleoprotein (266-280)
 - SARS-CoV-2 Nucleoprotein (271-285)
 - SARS-CoV-2 Nucleoprotein (321-335)
 - SARS-CoV-2 Nucleoprotein (331-345)
 - SARS-CoV-2 Nucleoprotein (341-355)
 - SARS-CoV-2 Nucleoprotein (346-360)
 - SARS-CoV-2 Nucleoprotein (351-365)
 - SARS-CoV-2 Nucleoprotein (353-370)
 - SARS-CoV-2 Nucleoprotein (356-370)
 - SARS-CoV-2 Nucleoprotein (51-65)
 - SARS-CoV-2 Nucleoprotein (61-75)
 - SARS-CoV-2 Nucleoprotein (86-100)
 - SARS-CoV-2 Nucleoprotein 1 (56-70)
 - SARS-CoV-2 Nucleoprotein 2 (326-340)
 - SARS-CoV-2 ORF7a-10 (69-86)
 - SARS-CoV-2 Spike (1192-1200)
 - SARS-CoV-2 Spike (1196-1205)
 - SARS-CoV-2 Spike (1197-1206)
 - SARS-CoV-2 Spike (236-250)
 - SARS-CoV-2 Spike (757-765)
 - SARS-CoV-2 Spike (781-795)
 - SARS-CoV-2 Spike (975-983)
 - SARS-CoV-2 Spike (975-989)
 - SARS-CoV-2 Spike (991-1000)
 - SARS-CoV-2 Spike (996-1004)
 - SARS-CoV-2 Spike (999-1007)
 - SARS-inhibitor 4
 - Scrambled LL-37 peptide
 - Secretin (rat)
 - Sendai Virus nucleoprotein (324-332)
 - T22 peptide
 - Temporin A
 - Temporin L
 - Tritrpticin
 - VP4 (449-454) Nora virus
 - VP4 (93-101) Nora virus
 - [5-FAM]-LL-37
 - [Cys]-Influenza Virus Nucleoprotein (311 – 325)
 
 - Biotin Labeled
- BCL-6 corepressor Human (BCOR) (498-514) C-terminal Biotin
 - beta-Amyloid (1-10) Biotin
 - beta-Amyloid (1-11) Biotin
 - beta-Amyloid (1-12) Biotin
 - beta-Amyloid (1-13) Biotin
 - beta-Amyloid (1-14) Biotin
 - Biotin Apolipoprotein A-I (APOA1)(86-101)
 - Biotin BRC4 (1517-1551)
 - Biotin gliadin-derived peptide
 - Biotin HER-2 substrate peptide
 - Biotin phosphorylated CDK7 (157-169)
 - Biotin phosphorylated JAK1 substrate peptide
 - Biotin SBP1
 - Biotin SBP2
 - Biotin Steroid Receptor Coactivator-1 (SRC-1) (676-700)
 - Biotin Substance P
 - Biotin TAT (48-60)
 - Biotin-aMp3
 - biotin-aMptD
 - Biotin-Axltide Peptide substrate
 - Biotin-beta-Amyloid (1-15) human
 - Biotin-Desmoglein-3 DSG3 (50-79)
 - Biotin-GLP-1 (7-36)
 - Biotin-Histone H3 (14-34) K23Me3
 - Biotin-Histone H3 (14-34) pT22 K23Me3
 - Biotin-Influenza A NP (147-155) (H-2Kd)
 - Biotin-Jak2 substrate
 - Biotin-LPETAG N-terminal Sortagging
 - Biotin-LPETGG N-terminal Sortagging
 - Biotin-Nrf2 (69-84)
 - Biotin-PEG2-Claudin-3
 - Biotin-PEG2-Claudin-6
 - Biotin-PEG2-Claudin-9
 - Biotin-TAT (47-57)
 - Biotin-β Amyloid (1-42) Human
 - Biotinylated L57
 - C-Terminal Sortagging-AAA-[Lys(Biotin]
 - C-Terminal Sortagging-[Lys(Biotin]
 - Galanin (2-13)-Biotin
 - Galanin (3-13)-Biotin
 - Histone H2A (1-20)-GGK(Biotin)
 - Histone H3 (1-20)
 - Histone H3 (1-20)-[S]-Biotin
 - Histone H3 (1-22) K4Me3-Biotin
 - Histone H3 (1-22) K9Me1-Biotin
 - Histone H3 (10-29)-Biotin
 - Histone H3 (20-39)-Biotin
 - MHC class II antigen E alpha (52-68)-Biotin
 - Pyroglutamyl beta-Amyloid (4-14) Biotin
 - [Biotin]-GLP-1
 
 - Cancer Peptides
- A6 peptide
 - AD01 N-terminal Q
 - ARF peptide
 - Bak BH3
 - Bevacizumab Light chain
 - Bid BH3 Peptide
 - BIM 187
 - Bim BH3, Peptide IV
 - Braftide
 - C7
 - CooP
 - Cyclo(CLLFVY)
 - D-Arg PEP
 - dodecapeptide AR71
 - DOTA-(Tyr3)-octreotate Acetate Salt
 - FAM49B (190-198) Mouse
 - FFW
 - FREG peptide
 - GRGD-acid
 - HIF-1 α (556-574)
 - Infliximab Heavy chain (46-60)
 - PEN-FFW
 - Proapoptotic Peptide KLA
 - RAGE antagonist peptide
 - Rituximab Light chain (41-55)
 - RKOpep
 - XL 13m
 - YSA acid
 - [Tyr0]-Apelin-13
 
 - Cell Penetrating Peptides - CPP
- (Arg)9 peptide
 - (RFR)4XB
 - 3xFlag [DYKDDDDK]
 - Acetyl-Arg9
 - Angiopep 2
 - Antennapedia peptide
 - Antennapedia peptide amide
 - Antennapedia peptide Arg
 - Azhx-Penetratin
 - C105Y
 - CPP9
 - Cys(Npys)-Antennapedia peptide amide
 - DYKDDDDK FLAG peptide
 - Flexible Glycine Linker (3xGGGGS)
 - L17E
 - MART-1 (26-35)
 - MHV EP™
 - N3-His tag
 - Penetratin peptide
 - Pep – 1 – Chariot
 - PR9
 - RAG8
 - Secretoneurin Mouse Rat
 - T peptide
 - TAT (47-57) peptide
 - TfR targeting sequence
 - [5-FAM]-(RXR)4XB
 
 - Click Peptides
 - COVID-19 Peptides
- ACE2 – Angiotensin-Converting enzyme 2 – peptide library
 - Biotin-SARS-CoV-2 Spike RBD 319-335 peptide
 - Biotin-SARS-CoV-2 Spike RBD 336-347 peptide
 - Biotin-SARS-CoV-2 Spike RBD 348-357 peptide
 - Biotin-SARS-CoV-2 Spike RBD 352-365 peptide
 - Biotin-SARS-CoV-2 Spike RBD 371-394 peptide
 - Biotin-SARS-CoV-2 Spike RBD 395-430 peptide
 - Biotin-SARS-CoV-2 Spike RBD 513-520 peptide
 - Biotin-SARS-CoV-2 Spike RBD 523-541 peptide
 - Biotin-SARS-CoV-2 Spike RBM 438-458 peptide
 - Biotin-SARS-CoV-2 Spike RBM 450-473 peptide
 - Biotin-SARS-CoV-2 Spike RBM 480-496 peptide
 - Biotin-SARS-CoV-2 Spike RBM 500-509 peptide
 - CoV Main Protease (Mpro) Substrate
 - SARS CoV-2 Spike (S) protein – Peptide library
 - SARS-CoV 3C-like protease (3CLpro) substrate (C-terminal KK-acid)
 - SARS-CoV-2 Membrane protein (141-158)
 - SARS-CoV-2 Membrane protein (172-188)
 - SARS-CoV-2 NSP7 (26-40)
 - SARS-CoV-2 Nucleocapsid (N) protein – Peptide library
 - SARS-CoV-2 Nucleoprotein 2 (261-275)
 - SARS-CoV-2 ORF3a (26-40)
 - SARS-CoV-2 Spike RBD 319-335 peptide
 - SARS-CoV-2 Spike RBD 336-347 peptide
 - SARS-CoV-2 Spike RBD 348-357 peptide
 - SARS-CoV-2 Spike RBD 352-365 peptide
 - SARS-CoV-2 Spike RBD 371-394 peptide
 - SARS-CoV-2 Spike RBD 395-430 peptide
 - SARS-CoV-2 Spike RBD 513-520 peptide
 - SARS-CoV-2 Spike RBD 523-541 peptide
 - SARS-CoV-2 Spike RBM 438-458 peptide
 - SARS-CoV-2 Spike RBM 450-473 peptide
 - SARS-CoV-2 Spike RBM 480-496 peptide
 - SARS-CoV-2 Spike RBM 500-509 peptide
 - Spike Protein (SARS-CoV-2) Peptide Pool
 - UCI-1
 - Variants package of SARS CoV-2 Spike (S) protein mutation – Peptide library
 
 - Fluorescent Peptides
- (Cbz-LGR)2-[Rh110]
 - (N-Cbz-Nle-KRR)2-[Rh110]
 - (PFR)2-[Rh110]
 - (Tos-GFHR)2-[Rh110]
 - (Tos-GPR)2-[Rh110]
 - (Tos-YASR)2-[Rh110]
 - 5-FAM-Fz7-21
 - AAA-C(AF647) C-Terminal Sortagging
 - Ac-Arg-Gly-Lys(Ac)-AMC
 - Ac-GPLD-[Rh110]-[D-Pro]
 - Ac-RGK-[AMC]
 - Ac-RLR-[AMC] Proteasome Substrate
 - Ac-RLR-[Rh110]-[D-Pro]
 - Acetyl-Alpha-2-antiplasmin-[AF680]
 - Acetyl-Histone H4 (1-21) K5Ac, K8Ac, K12Ac, K16Ac-GG-[Lys(5-FAM)]
 - Acetyl-Histone H4 (1-23) K16Ac-GG-[Lys(5-FAM)]
 - Acetyl-Histone H4 (1-23)-GG-[Lys(5-FAM)]
 - acfTAT
 - ACTH (1-24) -[5-FAM]
 - AF488 6xHis Tag
 - AF488 Insulin
 - AF488 Plectin-1-targeting peptide
 - AF647 RGD peptide
 - C-terminal Sortagging-[Cys(AF488)]
 - C-terminal Sortagging-[Cys(AF680)] acid
 - C-terminal Sortagging-[Cys(AF680)] amide
 - C-terminal Sortagging-[Cys(Sulfocyanine3)]
 - C-terminal Sortagging-[Cys(Sulfocyanine5)]
 - C-terminal Sortagging-[Cys(Sulfocyanine7)]
 - Cathepsin G FRET substrate [5-FAM]/[6-TAMRA]
 - Cys(BDP630/650)-Galanin (1-30) Human
 - DNA damage-binding protein 2 (DDB2)-[Cys(AF647)]-amide
 - ERAAP substrate Ep
 - Exendin-4 [Lys(AF647)]
 - FLAG tag (Cy3B)
 - Fluorescein HLA-A*02:01 HBV core (18-27)
 - Formyl-MLF-[Cys(AF488)]
 - GGG-C(AF647) C-Terminal Sortagging
 - GGG-[K(5-TAMRA)] C-terminal Sortagging
 - Ghrelin-[Cys(AF647)] Human
 - GLP-1 (7-36) [Cys(Sulfocyanine5)]
 - Glucagon (1-29)-[Cys(Cy5)]
 - Glucagon (1-29)-[Lys(AF647)]
 - GRGD-[Cys(AF647)]
 - H-Met-Gly-Pro-[AMC].HCl
 - HCV NS3 protease FRET substrate
 - Histone H3 (1-15) K4Me3, K9Ac, pS10
 - Histone H3 (1-20) K4Me2-GG-[Lys(5-FAM)]
 - Histone H3 (1-20) K4Me3, K9Ac, pS10-GG-[Cys(Aurora™ Fluor 647)]
 - Histone H3 (1-20) K4Me3, K9Ac, pS10-GG-[Lys(5-FAM)]
 - Histone H3 (1-20) K4Me3, K9Ac-GG-[Lys(5-FAM)]
 - Histone H3 (1-20) K4Me3, pS10-GG-[Lys(5-FAM)]
 - Histone H3 (1-20) K4Me3-GG-[Cys(Aurora™ Fluor 647)]
 - Histone H3 (1-20) K4Me3-GG-[Lys(5-FAM)]
 - Histone H3 (1-20) pT3, K4Me3-GG-[Lys(5-FAM)]
 - Histone H3 (1-20)-GG-[Cys(Aurora™ Fluor 647)]
 - Histone H3 (1-20)-GG-[Lys(5-FAM)]
 - Histone H3-GG-[Cys(5-FAM)]-amide
 - Insulysin FRET substrate [Mca]/[Dnp]
 - KHLF-[AMC]
 - LasB FRET substrate
 - Leu-AFC.HCl
 - Melittin [Cy5]
 - PFR-[AMC]
 - Plasmin-[AMC] substrate
 - Ser3-n-octanoyl Ghrelin-[Cys(AF647)] Human
 - SMAC/DIABLO [Lys(5-FAM)]
 - SMAC/DIABLO-[Cys(AF647)]
 - SMRT peptide-(Cys[AF633])
 - Suc-LLVY-[AMC]
 - Suc-LLVY-[Rh110]-[D-Pro]
 - [β-Ala]-[Lys(5-TAMRA)]-acid
 - [β-Ala]-[Lys(AMCA)]-acid
 - [5-FAM] Antennapedia peptide amide
 - [5-FAM] EGFR/kinKDR peptide substrate
 - [5-FAM] Histone H3 (1-14) K4Me3
 - [5-FAM] Kemptide
 - [5-FAM]-(KFF)3K
 - [5-FAM]-(RFR)4XB
 - [5-FAM]-Arg9
 - [5-FAM]-beta-Amyloid (1-15) Human
 - [5-FAM]-C7
 - [5-FAM]-CADY
 - [5-FAM]-Collagen alpha-1(I)-(5-TAMRA)
 - [5-FAM]-CRAMP (6-39)
 - [5-FAM]-EB1
 - [5-FAM]-ERKtide
 - [5-FAM]-Galanin (1-30) Human
 - [5-FAM]-GLP-1
 - [5-FAM]-GLP-1 (7-36)
 - [5-FAM]-IFN-γ receptor (pTyr) peptide
 - [5-FAM]-M918
 - [5-FAM]-MAP
 - [5-FAM]-MPG∆NLS
 - [5-FAM]-PR9
 - [5-FAM]-PTH (1-34)
 - [5-FAM]-pVec
 - [5-FAM]-RGD peptide
 - [5-FAM]-RKOpep
 - [5-FAM]-RPKPQQFFGLM-NH2
 - [5-FAM]-SRC Substrate Peptide
 - [5-FAM]-TAT
 - [5-FAM]-TAT (47-57) amide
 - [5-FAM]-Tp10
 - [5-FAM]-Tyr-Ahx-Ser-Asp-Lys-Pro-acid
 - [5-FAM]-Val
 - [5-FAM]-VGB4
 - [5-FAM]/[Lys(Dabcyl)]-CoV Main Protease (Mpro) Substrate
 - [5-FAM]/[Lys(Dnp)]-SARS-CoV-2 S1/S2
 - [5-TAMRA] Galanin, Human
 - [5-TAMRA]-ATIA agonist [sar1, Ile4, Ile8]
 - [5-TAMRA]-Galanin (1-30) Human
 - [5-TAMRA]-LPETAG N-terminal Sortagging
 - [5-TAMRA]-LPETGG N-terminal Sortagging
 - [5-TAMRA]/[Lys(BHQ-2)] Ubiquitin
 - [5-TAMRA]/[Lys(BHQ-2)]-CoV Main Protease (Mpro) Substrate
 - [6-FAM]-Arg8
 - [Atto655]-LifeAct (Abp140 1-17)
 - [Aurora™ Fluor 647]-RGD peptide
 - [Azhx]-[Lys(Mca)]-P11-8
 - [BDP630/650]3-halphaCGRP (calcitonin gene-related peptide)
 - [Cy3B]-LifeAct (Abp140 1-17)
 - [Cys(AF488)]-Penetratin
 - [Cys(AF647)]-Jak2/3 substrate
 - [DABCYL]/[Glu(EDANS)] SARS-CoV-2 3C-like protease (3CLpro) substrate
 - [FITC]-Ahx-(KKEEE)3K carrier peptide
 - [FITC]-C7
 - [FITC]-pCREB (127-134) substrate
 - [MCA]/[Lys(Dnp)]-CoV Main Protease (Mpro) Substrate
 - [Rhodamine Green]-LifeAct (Abp140 1-17)
 - [Sulfo-Cyanine3]-LifeAct (Abp140 1-17)
 - [Sulfo-Cyanine5]-Val-Pro-Valp(OPh)2
 - [TAMRA]-beta-Amyloid (1-15) Human
 - ™PRSS4 (199-207) fluorogenic peptide
 
 - GPCR Modulators
 - Growth Factors and Cytokines
- Boc-Val-Pro-Arg-AMC
 - CHKtide
 - CSK substrate
 - EGFR (963-975)
 - EGFR/kinKDR peptide substrate
 - HSP70/DnaK Substrate Peptide
 - IRS-1 substrate
 - LHRH
 - N-methylated ERAP1substrate
 - Phosphorylated CHKtide
 - Phosphorylated Sakamototide
 - PKA Substrate
 - Renin substrate
 - Sakamototide
 - SAMS peptide
 - Somatostatin 14 (human, rat, mouse, pig, chicken, frog)
 - SRC Substrate Peptide
 
 - Hematology Related Peptides
 - Histone Peptides
- Acetyl-Histone H4 (1-21)
 - H4 peptide (16-23)
 - Histone H1 derived peptide
 - Histone H2A (1-20)
 - Histone H2A (78-86)
 - Histone H3 (1-18)
 - Histone H3 (1-20) K4Me3
 - Histone H3 (1-20) K4Me3, K9Ac, pS10-GG-Biotin
 - Histone H3 (1-21)
 - Histone H3 (1-21) K4ac
 - Histone H3 (1-21) K4Me2
 - Histone H3 (1-21) K4Me3
 - Histone H3 (1-21) K9Me2
 - Histone H3 (1-22)
 - Histone H3 (1-8)
 - Histone H3 (20-36) K27Me3
 - Histone H3 (22-30) K27Me3
 - Histone H3 (30-41) K36Me2
 - Histone H3 (32-38) K36Me2
 - Histone H3 (32-47)
 - Histone H3-GGC-amide
 - Histone H3.2 (1-44)
 - Histone H3.3 (1-44)
 - Histone H4 (1-21)
 - Histone H4 (1-21) R3Me1
 - Histone H4 (1-21) R3Me2
 - Histone H4 (1-23)
 - Osteogenic Growth Peptide (OGP)
 - SETD8 Peptide
 
 - Hormones
- ACTH (7-39) human
 - Alexamorelin
 - Alpha mating factor – WHWLQLKPGQPMY
 - ANP (1-23)
 - ANP (13-26)
 - ANP (7-20)
 - ANP (7-23)
 - ANP (9-22)
 - ANP 1-28 Human
 - BNP-32 human
 - Bradykinin
 - Calcitonin, human – Agonist of the calcitonin receptor CTR
 - Calcitonin, Rat
 - Calcitonin, Salmon
 - CCL2 (MCP-1)
 - Exendin 3 (9-39) amide
 - Exendin 4 (4-39)
 - Exendin 4 – Potent GLP-1R agonist
 - Gastrin Releasing Peptide, human
 - GIP (1-42)-[C] human
 - GIP (Pro 3)
 - GIP, human
 - GLP-1 (1-37)
 - GLP-1 (7-36) amide
 - GLP-1 (9-36) amide
 - Glucagon (3-29)
 - Glucagon like-peptide-2 (GLP-2)
 - GPS1573
 - GRP (14-27), human, porcine
 - h-Chemerin-9 (149-157)
 - Insulin beta Chain Peptide (15 – 23)
 - Isotocin
 - Liraglutide
 - Motilin (1-10)
 - Motilin (1-12)
 - Motilin (human, porcine)
 - Oxytocin
 - Pro-BNP (47-76)
 - Protirelin – Thyrotropin-releasing hormone (TRH) (CAS: 24305-27-9)
 - PTH (1-13) Human
 - PTH (1-34) human
 - PTH (13-34) Human
 - RANTES (CCL5)
 - [Glu2]-TRH peptide (CAS: 85541-78-2)
 
 - Immunology - Antigens/Epitotes/Pools/Librairies
- 2-Furoyl-LIGRL-amide
 - 4-Fluorobenzoyl-A20FMDV2
 - A*02:01/Human Survivin (96-104) peptide – LTLGEFLKL
 - A*02:01/Human Survivin/SurA2.M (LMLGEFLKL) peptide
 - AAV8 capsid protein
 - Acetyl-HIV-1 reverse transcriptase (A2-YI9)
 - Acetyl-TGF-beta 2-LAPbeta (259- 269)
 - AF12198
 - AH1 Sequence (6-14)
 - AIP-I
 - AIP-II
 - AIP-III
 - AIP-IV
 - Allergen Ara h 1 (560-572)
 - alpha-Gliadin (31 – 43)
 - Annexin A1 (2-12)
 - Ara h 2 (147-155) peanut Allergen
 - Ara h 3 (278-284) peanut Allergen
 - Ara h 6 (120-131) peanut Allergen
 - Ara h1 (555-577) peanut Allergen
 - AYPGFK Protease-Activated Receptor-4 (PAR-4)
 - B-peptide
 - BAM (8-22)
 - BAT3 (340-347), human
 - BDC2.5 mimotope 1040-51
 - Biotin-FluM1 (58-66) peptide
 - Biotin-MAGE-A1 (278-286) peptide
 - Biotin-MAGE-A2 (157-166) peptide
 - Biotin-NY-ESO-1 (157-165) C165V peptide
 - Biotin-Ova (323-339) peptide
 - Biotin-PADRE peptide AKFVAAWTLKAAA
 - C5A
 - CD20 (188-196) peptide – SLFLGILSV
 - CEF (HLA Class I Control) Peptide Pool
 - CEFT Control Peptide Pool (HLA Class I Control)
 - Cilengitide (Linear)
 - CMV IE-1 (213-225)
 - CMV pp65 (113-121) peptide – VYALPLKML
 - CMV pp65 (120-129) peptide – MLNIPSINV
 - CMV pp65 (415-429) (HLA-B7)
 - CMV pp65 (485-500)
 - CMV pp65 (495-503) (HLA-A2)
 - CMV pp65 (511-525)(HLA-B44)
 - Compstatin
 - Cyclo(-RGDyK)
 - Cyclo(RGDfK)
 - EBV BMLF1 (280-288) (HLA-A2)
 - EBV BMLF1 (280-288) peptide – GLCTLVAML
 - EBV BNRF1 (1238-1252)
 - EBV BRLF1 (134-142) (HLA-A11)
 - EBV BRLF1 (148-156) (HLA-A3)
 - EBV BRLF1 (28-37) (HLA-A24)
 - EBV BZLF1 (190-197) (HLA-B8)
 - EBV BZLF1 (40-48) (HLA-E)
 - EBV EBNA3A (158-166) (HLA-B8)
 - EBV EBNA3A (325-333) (HLA-B8)
 - EBV EBNA3A (379-387) (HLA-B7)
 - EBV EBNA3A (458-466) (HLA-B35)
 - EBV EBNA3A (603-611) (HLA-A3)
 - EBV EBNA3B (416-424) (HLA-A11)
 - EBV EBNA3C (258-266) (HLA-B27)
 - EBV EBNA3C (281-290) (HLA-B44)
 - ELA Elabela/Toddler-32
 - Fibrinogen, b43-63
 - Fibrinopeptide
 - Flu-HA-B (306-318) MHC II DRB1*01:01
 - FluM1 (58-66) peptide – GILGFVFTL
 - GHK tripeptide
 - gp100 (25-33) epitope – KVPRNQDWL
 - gp100 (280-288) A288V HLA-A*0201 antigen peptide – YLEPGPVTV
 - GP33 (1-9)
 - gp96-II
 - Haemagglutinin (HA) peptide YPYDVPDYA
 - HCV NS5B (2594-2602) peptide – ALYDVVTKL
 - Her-2/neu (85-94) peptide – LIAHNQVRQV
 - HIV-1 p17 Gag (77-85) peptide – SLYNTVATL
 - HIV-1 reverse transcriptase (A2-YI9)
 - HLA-A*02:01 HBV core (18-27)
 - HLA-A*02:01 NY-ESO-1 (157-165)
 - HLA-A*02:01 Polymerase (400-408)
 - HLA-A*02:01 Polymerase (417-425)
 - HLA-DRB1*1501 peptide
 - HPV E7 protein (49-57)
 - HPV16 E7 (86-93)
 - HS1 protein (160-168)
 - hsBCL9CT-24
 - Human PD – L1 inhibitor V
 - I-A(g7) BDC2.5 mimotope
 - IDR 1002
 - IFNB1 (118-132) Human
 - IL-33 peptide
 - Influenza A HA (306-318)
 - Influenza A NP (265-273) (HLA-A3)
 - Influenza A NP (380-388) (HLA-B8)
 - Influenza A NP (383-391) (HLA-B27)
 - Influenza A NP (44-52) (HLA-A1)
 - Influenza A NP (91-99) (HLA-A68)
 - Influenza A PB1 (591-599) (HLA-A1)
 - Interleukin-27 subunit beta (22-30)
 - KD20 peptide
 - MAGE-A p248V9 peptide – YLEYRQVPV
 - MAGE-A p248V9 scrambled (RQYVELPYV)
 - MAGE-A1 (278-286) peptide – KVLEYVIKV
 - MAGE-A1 (278-286) scrambled (ELIVKVYKV)
 - MAGE-A2 (157-166) peptide – YLQLVFGIEV
 - MAGE-A2 (157-166) scrambled (VLVYFQEIGL)
 - MAGE-A3 (112-120) peptide – KVAELVHFL
 - MAGE-A3 (FLWGPRALV)
 - MAGE-A3 (IMPKAGLLI)
 - MBP-B MHC II DRB1*15:01 (84-102)
 - Melan-A (26-35) A27L peptide – ELAGIGILTV
 - Melan-A (26-35) peptide – EAAGIGILTV – CAS: 156251-01-3
 - Melan-A (26-35) scrambled (AIEIAGGLTV)
 - MHC binding peptides prediction
 - MOG (34-56) Human amide
 - MOG (35-51) cit46 human
 - MOG (35-55) amide Mouse, Rat
 - MUC1 (12-20) peptide – LLLLTVLTV
 - Myoglobin 137-148 MHC II DRB1*03:01
 - Nangibotide
 - NY-ESO-1 (123-137) DRB1*04:01 peptide – LKEFTVSGNILTIRL
 - NY-ESO-1 (157-165) C165V peptide – SLLMWITQV
 - NY-ESO-1 (157-165) C165V scrambled (MSILWQLVT)
 - NY-ESO-1 (157-165) peptide – SLLMWITQC
 - ORF65 (131-140) [Murid herpesvirus 4]
 - OVA (250-264)
 - OVA (251-264)
 - OVA (323 – 339) amide
 - Ova (323-339) peptide – ISQAVHAAHAEINEAGR
 - OVA 257 264 peptide – SIINFEKL
 - OVA 257 264 peptide SIINFEKL – KLH conjugate
 - OVA 257-264 scrambled (FILKSINE)
 - OVA Peptides Pool
 - Ovalbumin (324-338), chicken, quail
 - Ovalbumin (324-340) acetyl/amide, chicken
 - ovalbumin (371-382), chicken
 - P17
 - PADRE peptide – AKFVAAWTLKAAA
 - Palmitoyl GHK tripeptide
 - PD-1 (21-35)
 - PD-1 (24-38)
 - PD-1 (27-41)
 - Peptide antigen and epitope catalog
 - Peptide Tyrosinase (Asp371) – HLA-A*0201 (YMDGTMSQV)
 - Pip6a
 - PLP (139-151)
 - PMX 205
 - PMX 53
 - PRAME (100-108) HLA-A*0201
 - Restricted PADRE peptide- ak(Cha)VAAWTLKAAa-Ahx-C
 - RS09/Toll Like Receptor TLR4 agonist – APPHALS – CAS 1449566-36-2
 - S2-16
 - Se™elanotide
 - SMAP-18
 - SPA4 Peptide
 - survivin (baculoviral IAP repeat-containing protein 5) (21-28)
 - SYFPEITHI – MHC binding peptide
 - TET 830 modified/T-helper epitope from tetanus toxoid – AQYIKANSKFIGITEL
 - TET 830/Tetanus Toxin (830-844) peptide – QYIKANSKFIGITEL
 - Tetanus Toxin P2 (830 – 844)
 - TetTox-B (830-843) MHC II DRB1*07:01
 - TKD (450-463)
 - Tregitope 084
 - Tregitope 289
 - TRP-2 Peptide (180-188) – SVYDFFVWL
 - Uty HY Peptide (246-254) Mouse
 - V5 peptide
 - Vitronectin (367-378)
 - [Ala144]-PLP (139-151)
 
 - Ion Channels and Transporters
- (Dap22)-ShK
 - 8xHis-ProTx-II
 - Aah-II
 - Acetyl-Claudin-3
 - Acetyl-Claudin-6
 - Acetyl-Claudin-9
 - ACT1
 - ADWX-1
 - Agitoxin-2
 - alpha-cobratoxin
 - AmmTx3
 - Apamin
 - APETx2
 - Apolipoprotein A-I (APOA1)(86-101)
 - Apolipoprotein KV domain (67 – 77)
 - ATTO488-Charybdotoxin
 - ATTO488-ProTx-I
 - ATTO488-ProTx-II
 - ATX-II
 - BDS-I
 - BeKm-1
 - Biotin-ProTx-I
 - BmP02
 - C-Peptide (57-87) human
 - Charybdotoxin
 - Chlorotoxin
 - Conantokin-G
 - Crotamine
 - Cy3-Crotamine
 - Cy5-Huwentoxin-IV
 - Cy5-ProTx-I
 - Cy5-ProTx-II
 - D-GsMTx4
 - Dc1a
 - Echistatin α1 isoform
 - GAP26
 - GaTx2
 - GrTx1
 - GsAF-1
 - GsAF-2
 - GsMTx4
 - Guangxitoxin-1E
 - Hainantoxin-III
 - Hainantoxin-IV
 - Hm1a
 - HSA (55-66)
 - HsTx1
 - Huwentoxin-I
 - Huwentoxin-IV
 - Huwentoxin-XVI
 - Iberiotoxin
 - Jingzhaotoxin-34
 - Jingzhaotoxin-III
 - Kaliotoxin-1
 - Latartoxin-1a
 - Leiurotoxin-1
 - Leiurotoxin-1 Dab7
 - Lys-conopressin-G
 - Mambalgin-1
 - Margatoxin
 - Maurocalcine
 - Maurotoxin
 - Melittin
 - MitTx (MitTx-α + MitTx-β)
 - Morphiceptin
 - MT7 – Muscarinic Toxin 7
 - NMB-1
 - Obtustatin
 - OD1
 - Panx-1 mimetic inhibitory peptide
 - Phlotoxin-1
 - Phrixotoxin-2
 - Phrixotoxin-3
 - PNC 27
 - ProTx-I
 - ProTx-II
 - ProTx-II-Biotin
 - ProTx-III
 - Psalmotoxin-1 (PcTx1)
 - Purotoxin-1
 - Rho-Conotoxin-TIA
 - ShK – Stichodactyla toxin
 - Stromatoxin-1 (ScTx1)
 - Tamapin
 - TAMRA-Charybdotoxin
 - TAMRA-ShK
 - Tertiapin Q
 - Tf2 scorpion toxin
 - U2-sicaritoxin-Li1a
 - Waglerin-1
 - Waglerin-1-FAM
 - α-Conotoxin BuIA
 - α-Conotoxin PIA
 - α-conotoxin-GI
 - α-conotoxin-GID
 - α-conotoxin-IMI
 - α-conotoxin-MI
 - α-conotoxin-PeIA
 - αC-Conotoxin-PrXA
 - β-Pompilidotoxin
 - µ-conotoxin KIIIA
 - µ-conotoxin-CnIIIC
 - µ-conotoxin-GIIIB
 - μ-conotoxin-PIIIA
 - µO conotoxin MrVIB
 - ρ-Da1a (AdTx1)
 - ω-agatoxin-IVA
 - ω-Conotoxin-GVIA
 - ω-Conotoxin-MVIIA
 - ω-Conotoxin-MVIIC
 - ω-Conotoxin-SO3
 - ω-Hexatoxin-Hv1a
 - ω-Tbo-IT1
 
 - Multiple sclerosis peptides
- Biotin-Mouse MOG (35-55) peptide
 - Experimental Autoimmune Encephalomyelitis KIT
 - Human MOG Peptides Pool
 - MBP (1-11) human: Ac-ASQKRPSQRHG CAS 106128-98-7
 - MBP (84-97) – VVHFFKNIVTPRTP
 - MBP (85–99) – EKPKVEAYKAAAAPA
 - MOG (183-191) – FVIVPVLGP
 - MOG (35-55), human peptide
 - MOG (91-108) peptide – SDEGGYTCFFRDHSYQEE
 - MOG (92-106) peptide – DEGGYTCFFRDHSYQ
 - MOG (97-108) peptide- TCFFRDHSYQEE
 - Mouse MOG (35-55) peptide
 - PLP (139-151) peptide – HSLGKWLGHPDKF – [CAS 122018-58-0]
 - PLP (178-191): NTWTTCQSIAFPSK mouse, rat
 
 - Myelin Basic Protein (MBP) Peptides
 - Neuroscience Peptides
- (Ala11, D-Leu15)-Orexin B human
 - (Arg8) Vasopressin (AVP)
 - (Arg8) Vasotocin
 - (D-Pro7)-Angiotensin I/II (1-7)
 - (Des-octanoyl)-Ghrelin Human
 - Acein
 - Acetyl-Alpha-synuclein (1-13)
 - Acetylated alpha-synuclein (1-7) amide
 - ACTH (1-10) Human
 - ACTH (1-17) Human
 - ACTH (1-24) Human
 - ACTH (1-39) Human
 - ACTH (11-24)
 - ACTH (15-24) Cys
 - ACTH (18-39) Human
 - ACTH (7-38) Human
 - ACTH (7-39) Cys
 - Alpha-Casozepine
 - alpha-MSH
 - Alpha-synuclein (1-13)
 - Amylin (1-37) Human
 - Amyloid beta peptides
 - Angiotensin (Human, 1-7)
 - Angiotensin I
 - Angiotensin II Antipeptide
 - Angiotensin III
 - Angiotensin IV (3-8)
 - Apelin (65-76), human
 - Apelin-17 (human, bovine)
 - Apolipoprotein E fragment (133-149) – COG133 : LRVRLASHLRKLRKRLL (CAS : 514200-66-9)
 - Biotin-ACTH (1-39) Human
 - CCK octapeptide Cholecystokinin (26-33)
 - CE dipeptide
 - CMX-8933
 - CRF human, rat
 - Duck liver-derived peptide 2
 - Duck liver-derived peptide 3
 - Duck liver-derived peptide 4
 - EC dipeptide
 - Echinotocin neuropeptide
 - FMRFamide peptide
 - Galanin (1-13)
 - Galanin (1-15) Porcine, Rat
 - Galanin (1-17) Porcine
 - Galanin (13-20) Mouse
 - Galanin (2-12) acid
 - Galanin (2-13)
 - Galanin (2-13) acid
 - Galanin (2-30) acid
 - Galanin (3-13)
 - Galanin Human
 - Galanin Mouse, Rat
 - Galantide
 - Ghrelin Human
 - Ghrelin Rat, Mouse
 - GP dipeptide
 - GRP (18-27) (human, porcine, canine)
 - Hyp-Gly dipeptide
 - IFNB1 (118-132) Human deimmunised
 - Kinetensin
 - Kisspeptin 10 human
 - Kisspeptin 14 human
 - KLPGF peptide
 - L57
 - Leptin (116-130) Mouse
 - Leptin (93 – 105) Human
 - LRRKtide
 - MiniAp-4 peptide
 - Motilin (1-16)
 - Myhc-α 334-352
 - Neurokinin A (Substance K)
 - Neurokinin B (human, porcine)
 - Neuromedin U 25
 - Neuropeptide NPSF
 - Neuropeptide RFRP-1 (81-92)
 - Neuropeptide RFRP-2 (101-112)
 - Neuropeptide RFRP-3 (124-131)
 - Neuropeptide S human
 - Neuropeptide S mouse
 - Neuropeptide S rat
 - Neuropeptide Y (3-36) Human,Rat
 - Neurotensin
 - Nociceptin
 - NX 210
 - Orexin A (monkey)
 - Ovalbumin (154-159)
 - Ovotransferrin (328-332)
 - OXA (17-33)
 - Oxidised Alpha-synuclein (1-13)
 - Oxytocin (free acid)
 - Pep63
 - Peptide5
 - Polybia-MPII
 - SARS-CoV Peptide Antigen negative control
 - Spexin
 - Substance P
 - Thyroglobulin (Tg-FSP)
 - Thyroglobulin (Tg-VIF)
 - VIP (1-12)
 - VIP (6-28)
 - [5-FAM]-Galanin (2-30)-[Cys] (Human)
 - [Cys]-Galanin (1-30) Human
 - [Glp6,Pro9] Substance P (6-11)/Septide
 - [Pyr]-Apelin-13
 - α-CGRP (mouse, rat)
 
 - Other Categories
- 123B9
 - 14-3-3 zeta/delta (28-41)
 - 1D,6L-Lanthionine vasopressin
 - 3x DYKDDDDK peptide
 - a-Gliadin (229-246)
 - AD01
 - Adrenomedullin (22-52)
 - AF10847
 - alpha-gliadin (58-73)
 - Angiotensin II
 - APYTFGQGTK peptide
 - Autocamtide-2
 - Beclin-1
 - Biotin-DAG Peptide
 - BMAP-28
 - BMF
 - BNP-32, porcine
 - Bombesin – Potent natural agonist of the mammalian receptor GRPR
 - C-telopeptide
 - C5aR2 agonist
 - cAC 253
 - Caloxin 1C2
 - Cardiac Targeting Peptide CTP
 - CBL (167-180) Light
 - CBL (598-612) Light
 - CBL-B (22-37) Light
 - CBL-B (239-247) Light
 - CCK Octapeptide sulfated
 - Cecropin-B
 - Cellulose synthase 7
 - CIGB 300
 - Cilengitide
 - CNP (1-22), Human, Porcine
 - CREB327/active transcription factor CREB-A (113-126) Biotinyl, human
 - CREB327/active transcription factor CREB-A (113-126) [5-FAM] amide, Human
 - CREB327/active transcription factor CREB-A (113-126), human
 - Cysteine Peptide for DPRA tests
 - D11-FxxLF Coactivator peptide
 - DAG peptide
 - Dinitrophenyl ERAP1 peptide
 - DYKDDDDK peptide
 - Dystrophin (2690-2700)
 - Dystrophin (2765-2777)
 - Dystrophin (396-405)
 - Dystrophin (50-61)
 - Dystrophin, DMD
 - EHD1
 - elf18
 - Enfuvirtide (T-20)
 - Farnesylated a-factor
 - Fas blocking peptide
 - FEFEFKFK
 - Fibrinogen (377-395) Human
 - Flagellin 22 (flg22)
 - Formyl-MIFL-acid
 - Formyl-Δ-toxin (1-26)
 - FSY tripeptide
 - Fz7-21
 - GALA Peptide
 - Ganglioside GM1-binding peptides p3
 - Gastrin-1 Rat
 - GG-[AMC]
 - GIP (1-30) Human amide
 - GPRPK pentapeptide
 - GQPR tetrapeptide
 - GRGDS peptide
 - GS dipeptide
 - GSS tripeptide
 - Heart-homing peptide
 - Herceptide
 - HiBiT tag
 - HIV-1 Rev (34-50)
 - HPV16 E6 pep11**m
 - HSA (549-558)
 - Human Influenza Hemagglutinin (HA) Tag (YPYDVPDYA)
 - humanized anti-Tac (HAT) binding peptide
 - Hyp3-Bradykinin
 - Ig heavy chain V-III region Light
 - Ig heavy chain variable region Light
 - IGRP Catalytic Subunit-related Protein (206-214)
 - Insulin A Chain (A12-21)
 - Insulin B (9-23)
 - Integral membrane TGN38A (350-361) acetyl, mouse
 - Integrin-binding cell adhesive peptide
 - Intracellular Sigma Peptide
 - JAG-1 (188-204)
 - JAG-1, scrambled
 - Jelleine 1
 - Jelleine 2
 - Jelleine 3
 - Jelleine 4
 - Kallikrein-2 inhibitor
 - KLHY-[AMC]
 - KR-12-a5 (6-DL)
 - KRREILSRRPSYR-acid
 - Lasioglossin-III
 - LDVP peptide
 - Leuprolide Acetate
 - LLO (91 – 99)
 - Locustatachykinin I
 - LP2
 - Lys-Glu dipeptide
 - Lysine peptide for DPRA tests
 - M12 muscle-homing peptide
 - M2-Influenza
 - MAGEA4 (230-239) Light
 - MART-1 (27-35) (human)
 - MART-1 Fragment
 - Max-1 peptide
 - Mouse-ESC-derived cardiomyocyte-targeting peptide
 - Mucin 10 (153 – 165), EA2
 - MyHC (614-629)
 - N-L-Glutamyl-L-Lysine
 - Natalizumab (LC46-58)
 - Natalizumab LC46-58 KGN deimmunised
 - Natalizumab LC46-58 KSN deimmunised
 - nef peptide [Human immunodeficiency virus type 1] (73-82) acetyl/amide
 - nef protein (75-82) [Human immunodeficiency virus 1]
 - nef protein fragment (Acetyl/amide) [Human immunodeficiency virus 1]
 - Neuromedin U 8
 - Nictide
 - Octreotide
 - P007 (RXR)4XB
 - P12
 - P12 amide
 - P1A antigen
 - Palmitoyl GQPR tetrapeptide
 - Palmitoyl KTTKS pentapeptide
 - PEN (Mouse)
 - PEN, Human
 - PEN, Rat
 - Pepstatin A
 - Pepstatin A Biotin
 - Peripheral Myelin Protein P0 (180-199)
 - polyalanine peptide (pALA)
 - Polybia-MPI
 - Polyproline-13
 - pp89 phosphoprotein fragment [Mouse cytomegalovirus 1]
 - Proinsulin 90-104
 - Prolactin-releasing peptide (PrRP20)
 - Prostate-specific membrane antigen PSM (35-40), human
 - PTD-p65-P1 Peptide
 - PUMA BH3
 - R5
 - Relaxin 3 B1-22R amide
 - RGD peptide
 - RGD Peptide GRGDSPK
 - Rhodopsin Epitope Tag
 - S413-PV-[Cys(Npys)]
 - SARS-CoV-2 Spike (411-420)
 - SARS-CoV-2 Spike (976-984)
 - SBCleaner – Peptide decontamination
 - Semaglutide Heavy
 - SG dipeptide
 - SGS tripeptide
 - Shepherdin (79 – 87)
 - Sialokinins I
 - Sifuvirtude
 - Skeletal muscle-targeted peptide MSP
 - SmBiT
 - SMRT peptide
 - SOD1 (147-153) human
 - Spexin 2 (53-70) Human, Mouse, Rat
 - SRC-1 (676-700)
 - SSG tripeptide
 - Stabilized avi tag peptide
 - Steroid Receptor Coactivator-1 (SRC-1) (686-700)
 - Suc-LLVY-acid
 - Syntide 2
 - T-9 peptide
 - TAT-GSK’364A
 - Teduglutide (GLP2 2G)
 - Temporin SHF
 - Tet-20
 - Tetanus Toxin (1084-1099)
 - Tetanus Toxin (1174-1189)
 - Tetanus Toxin P30 (947-967)
 - Thrombin Receptor Antagonist
 - TNF-alpha (1-26), human
 - TP10
 - TPL-2tide
 - Transportan
 - TRAP-6 peptide
 - Triptorelin acetate
 - Truncated flagellin 22 (flg22)
 - Tumstatin (69-88)
 - Ub4ix
 - UBA3 (59-72) peptide
 - Urumin
 - V5 epitope tag
 - Vasculotide
 - VGB4
 - VIP (guinea pig)
 - Visperas1pY
 - Visperas2pY
 - Xenin
 - YSA amide
 - [5-FAM]-DAG peptide
 - [Azhx]-ANP (Human)
 - [Cys] citrullinated alpha enolase
 - [Cys]-Exendin 4
 - [Nle12] a-factor
 - [Tyr]-CNP22, Human
 - εV1-2
 
 - Protein-Protein Interactions
 - Stable Isotope Labeled (SIL) peptides catalog
- ADALQAGASQFETSAAK* – SIL Infliximab signature peptide
 - APYTFGQGTK* – SIL Adalimumab internal standard
 - ASGYTFTSYNMHWVK* – SIL Rituximab signature peptide quantifier
 - ASQSIGTNIHWYQQR* – SIL Cetuximab signature peptide qualifier
 - DYAMTWVR* – SIL Dupilumab signature peptide qualifier
 - GLEWIGAIYPGNGDTSYNQK* – SIL Rituximab signature peptide qualifier
 - Heavy Angiotensin II
 - Heavy calcitonin peptide
 - LEWIGEIDPSESNTNYNQK* – SIL Vedolozumab signature peptide
 - LSITIRPR* – SIL Dupilumab signature peptide quantifier
 - NYLAWYQQKPGK* – SIL Adalimumab signature peptide quantifier
 - QAPGQGLEWMGDINTR* – SIL Emicizumab signature peptide qualifier
 - SGGSIYNEEFQDR* – SIL Emicizumab signature peptide quantifier
 - SINSATHYAESVK* – SIL Infliximab signature peptide quantifier
 - SLEWIGAIDPYYGGTSYNQK* – SIL Dinutuximab signature peptide qualifier
 - SSSTAYMHLK* – SIL Dinutuximab signature peptide quantifier
 - YASESISGIPSR* – SIL Cetuximab signature peptide quantifier
 - YASESMSGIPSR* – SIL Infliximab signature peptide qualifier
 
 - TAT Conjugated Peptides
- Cys-TAT(48-60)
 - dfTAT
 - fTAT
 - gp91 ds-TAT
 - SMAC/DIABLO -TAT (48-60)-[Lys]
 - TAT (48-57)
 - TAT (48-59) amide
 - TAT (48-60) amide
 - TAT – GluR23Y
 - TAT 2-4
 - TAT protein (28-35) [Simian immunodeficiency virus]
 - TAT-AKAP79 (326-336) amide
 - TAT-AKAP79 (326-336) scrambled
 - TAT-AKAP79 (326-336) scrambled amide
 - TAT-Beclin 1
 - TAT-Beclin Scrambled
 - TAT-CHN9 (C-ter)
 - TAT-CN21
 - TAT-NR2B (C-ter)
 - TAT-Pro ADAM10 (709-729)
 - TAT-TRPV1 (736-745)
 
 
					






