CRAMP (1-39) – Antimicrobial Peptides – AMP

Cathelicidin-related anti-microbial peptide (CRAMP) is the mouse homologue of the human LL-37 anti-microbial peptide. CRAMP possesses potent anti-bacterial activity against Gram-positive and Gram-negative bacterial strains with no haemolytic activity. As well as displaying direct anti-microbial activity, CRAMP also binds to lipopolysaccharide (LPS) to neutralise its activity. CRAMP is encoded for by the Cramp gene which is highly expressed in bone marrow and up-regulated by infectious and inflammatory signals, CRAMP is secreted by cells such as neutrophils epithelial cells and macrophages. This peptide represents the mature, extended, form of CRAMP, longer than the 34 amino acid peptide originally isolated from the bone marrow of mice. CRAMP (1-39) has enhanced anti-microbial activity compared to CRAMP (6-39).

 

Technical specification

 KD20 peptide Sequence : H-ISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ-OH
 KD20 peptide MW : 4.419.27 g/mol
 KD20 peptide Purity : > 95%
 KD20 peptide Counter-Ion : TFA Salts
Peptide library synthesis KD20 peptide Delivery format : Lyophilized

Price

 

Product Size Price € Price $
CRB1000262-0.5 mg 0.5 mg 282€ 339$
CRB1000262-1 mg 1 mg 385€ 462$

For Bulk Orders