beta-Amyloid (1-40) Human – Amyloid Peptides

Amyloid β-peptide (Aβ) has been identified as the key subunit of the extracellular plaques found in the brains of patients with Alzheimer’s disease (AD) and Down’s syndrome (DS). Aβ has therefore been extensively studied as a potential target for treatment of AD. Aβ is formed from the cleavage of the large, transmembrane protein- APP (amyloid precursor protein). Cleavage of APP by β- and then γ-secretases results in the formation of Aβ. Aβ can aggregate to produce amyloid-β oligomers, which are thought to be highly neurotoxic. Over time Aβ can further aggregate to produce the characteristic senile plaques present in AD and DS. Aβ can be degraded by enzymes such as neprilysin, insulin degrading enzyme or endothelin converting enzyme. At physiological levels Aβ may be involved in controlling synaptic activity and neuronal survival. Aβ1-40 is a major C terminal variant of amyloid β constituting the most abundant AB peptide in the human brain.

 

Technical specification

 KD20 peptide Sequence : H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH
 KD20 peptide MW : 4.329.8 g/mol
 KD20 peptide Purity : > 95%
 KD20 peptide Counter-Ion : TFA Salts
Peptide library synthesis KD20 peptide Delivery format : Lyophilized

Price

 

Product Size Price € Price $
CRB1000087-0.1 mg 0.1 mg 281€ 338$
CRB1000087-0.5 mg 0.5 mg 385€ 462$
CRB1000087-1 mg 1 mg 533€ 640$
CRB1000087-5 mg 5 mg 1895€ 2274$

For Bulk Orders