hBD-2 peptide - Antimicrobial peptide and Kv1.3 channel blocker
Human beta-defensin-2 (hBD-2) peptide,also known as skin-antimicrobial peptide 1 (SAP1) is a cysteine-rich cationic antimicrobial peptide of 41 amino acids. It was originally isolated from skin cells of psoriasis patients. hBD-2 peptide,which belongs to the defensin family,is implicated in the innate immunity thanks to its antimicrobial activity. Thus,β-defensins can play a role at the cutaneous level by limiting the use of antibiotics in severe burns and disease like psoriasis. Moreover,at the pulmonary level,defensins might be involved in the resorption of the infection in cases of cystic fibrosis.
hBD-2 peptide is produced after stimulation of epithelial cells following their contact with some organisms like Gram-negative bacteria and Candida Albicans,fungus or cytokines such as TNF-alpha and IL-1 beta. This antimicrobial activity was shown to be microbicidal at concentrations greater than 1 µM and was lethal for E.Coli and pseudomonas (LD90 : 10 mg/mL) and Candida Albicans (LD90 : 25 mg/mL). Besides its antimicrobial activity , hBD-2 also exhibits proinflammatory properties as chemoattractants for memory T-cells,immature dendritic cells,mast cells and neutrophils.
hBD-2 peptide has also demonstrated inhibitory activity of the voltage-gated potassium channel Kv1.3 at picomolar concentration. Kv1.3 are overexpressed by T-cells in case of autoimmune disorders
Technical specification
![]() |
Sequence : GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP |
![]() |
MW : 4 328.22 Da (C188H305N55O50S6) |
![]() |
Purity : > 95% |
![]() |
Disulfide Bonds : Cys8-Cys37,Cys15-Cys30,Cys20-Cys38 |
![]() |
Counter-Ion : TFA Salts (see option TFA removal) |
![]() |
Delivery format : Freeze dried in propylene 2mL microtubes |
![]() |
Other names : Hbd 2 , skin-antimicrobial peptide 1,SAP1 |
![]() |
Peptide Solubility Guideline |
![]() |
Bulk peptide quantities available |
Price
| Catalog code | Size | Price € | Price $ USD |
| SB002-01MG | 0.1 mg | 275 | 344 |
| SB002-05MG | 0.5 mg | 963 | 1203 |
| SB002-1MG | 1 mg | 1512 | 1891 |
References
1- Soto E,Espinoza J,Nien JK,et al. J Matern Fetal Neonatal Med. (2007)
Human beta-defensin-2: A Natural Antimicrobial Peptide Present in Amniotic Fluid Participates in the Host Response to Microbial Invasion of the Amniotic Cavity
Objective: Human beta-defensin-2 (HBD-2) is a potent antimicrobial peptide that is part of the innate immune response. The purpose of this study was to determine whether HBD-2 is present in amniotic fluid and if its concentration changes with microbial invasion of the amniotic cavity (MIAC) and labor.
Study design: Amniotic fluid was retrieved by amniocentesis from 318 patients in the following groups: (1) mid-trimester (n=75); (2) term not in labor (n=28) and in labor (n=51); (3) preterm labor and intact membranes without MIAC who delivered at term (n=36),who delivered preterm without MIAC (n=52),and preterm labor with MIAC who delivered preterm (n=25); and (4) preterm premature rupture of membranes (preterm PROM) with (n=25) and without MIAC (n=26). MIAC was defined as a positive amniotic fluid culture for microorganisms. Amniotic fluid HBD-2 concentrations were determined using a sensitive and specific ELISA. Non-parametric statistics were used for analysis.
Results: (1) HBD-2 was detected in all amniotic fluid samples; (2) the concentration of HBD-2 did not change with gestational age from mid-trimester to term (p=0.8); (3) intra-amniotic infection was associated with a significant increase in amniotic fluid concentrations of HBD-2 in both women with preterm labor and intact membranes,and women with preterm PROM (p<0.05 for each comparison); (4) patients with preterm labor and a negative amniotic fluid culture who delivered preterm had a higher median amniotic fluid HBD-2 concentration than those with preterm labor who delivered at term (p=0.001); and (5) among patients with preterm labor without MIAC,those who had intra-amniotic inflammation (amniotic fluid white blood cell count>100 cells per mL) had a higher median amniotic fluid concentration of HBD-2 than those without this condition (p<0.002).
Conclusion: (1) Amniotic fluid contains HBD-2,a natural antimicrobial peptide,and this may account for some of the antimicrobial activity of amniotic fluid; (2) amniotic fluid HBD-2 concentrations are increased in women with MIAC,regardless of the membrane status (intact membranes or PROM); and (3) we propose that amniotic fluid HBD-2 is part of the innate immune system within the amniotic cavity.
- Amyloid Peptides
- Acetyl-ccbeta
- beta-Amyloid (1-11) Human
- beta-Amyloid (1-12) Human
- beta-Amyloid (1-14)
- beta-Amyloid (1-15) human
- beta-Amyloid (1-16) Human
- beta-Amyloid (1-17) Human
- beta-Amyloid (1-28) human
- beta-Amyloid (1-40) Human
- beta-Amyloid (1-6)-GGC Human
- beta-Amyloid (10-20) Human
- beta-Amyloid (11-20) Human
- Beta-Amyloid (12-20)
- beta-Amyloid (35-25)
- RNase A (77-82) Amyloidogenic peptide
- SEN 304
- Tau (195-209) Light
- Tau Peptide (45-73)
- Antimicrobial Peptides - AMP
- Abaecin
- Acetyl-Adhesin
- AcrAP1
- AcrAP1a
- AcrAP2
- AcrAP2a
- Alloferon 1
- Alloferon 2
- Alyteserin-1a
- Alyteserin-1b
- Alyteserin-1c
- Alyteserin-1d
- Alyteserin-2a
- Alyteserin-2b
- Alyteserin-2c
- Alyteserin-2Mb
- Anoplin
- Apidaecin IB
- B8R (20 – 27)
- Balteatide
- BMAP-18
- BMAP-18 (truncated)
- Buforin II
- Cecropin A
- Codesane
- CRAMP (1-39)
- CRAMP (6-39)
- CRAMP-18
- Cyclic L27-11
- Cycloviolacin O2 peptide
- Epinecidin-1
- FdM
- Feleucin-B01
- Gag (18-26) [Human immunodeficiency virus type 1] acetyl/amide
- Gag peptide [Simian immunodeficiency virus]
- Gag protein (181-189) acetyl/amide [Simian immunodeficiency virus]
- GLK-19
- hBD-2 peptide – human Beta Defensin 2
- HEL46-61
- Hepcidin-25 (LEAP-1 peptide)
- Histatin-5
- Histatin-8
- Hp1404
- Human Lysozyme (107-115)
- IDR-1
- Indolicidin
- Influenza Virus Nucleoprotein (311 – 325)
- KDAMP
- LL-13-37
- LL-17-29
- LL-17-32
- LL-37 amide
- LL-37 fragment (24-29)
- LL-37 fragment (30-34)
- LL-37 fragment (30-37)
- LL-37 peptide (CAP-18)
- Macropin 1
- Macropin 2
- Magainin II
- Magainin-1
- MALT1 substrate
- Mastoparan
- Mastoparan peptide
- mBD3 peptide – mouse Beta Defensin 3
- MP196
- N-formylated PSMalpha2
- N-formylated PSMalpha3
- P2-Hp-1935
- PA protein (Influenza A virus)
- PAF19
- PAF26
- Pantinin-1
- Pantinin-2
- Pantinin-3
- Pap12-6
- Parasin I
- Pseudin-2
- Sapecin B
- SARS-CoV-2 NSP13 (221-235)
- SARS-CoV-2 NSP13 (226-240)
- SARS-CoV-2 NSP13 (231-245)
- SARS-CoV-2 NSP13 (236-250)
- SARS-CoV-2 NSP13 (241-255)
- SARS-CoV-2 NSP13 (246-260)
- SARS-CoV-2 NSP13 (321-335)
- SARS-CoV-2 NSP13 (326-340)
- SARS-CoV-2 NSP13 (336-350)
- SARS-CoV-2 NSP13 (421-435)
- SARS-CoV-2 NSP13 (426-440)
- SARS-CoV-2 NSP13 (466-480)
- SARS-CoV-2 NSP13 (476-490)
- SARS-CoV-2 NSP13 (551-565)
- SARS-CoV-2 NSP13 (556-570)
- SARS-CoV-2 NSP13 (576-590)
- SARS-CoV-2 NSP13 (581-595)
- SARS-CoV-2 NSP7 (1-15)
- SARS-CoV-2 NSP7 (21-35)
- SARS-CoV-2 NSP7 (31-45)
- SARS-CoV-2 NSP7 (46-60)
- SARS-CoV-2 NSP7 (51-65)
- SARS-CoV-2 NSP7 (6-20)
- SARS-CoV-2 Nucleoprotein (1-17)
- SARS-CoV-2 Nucleoprotein (104-121)
- SARS-CoV-2 Nucleoprotein (126-140)
- SARS-CoV-2 Nucleoprotein (266-280)
- SARS-CoV-2 Nucleoprotein (271-285)
- SARS-CoV-2 Nucleoprotein (321-335)
- SARS-CoV-2 Nucleoprotein (331-345)
- SARS-CoV-2 Nucleoprotein (341-355)
- SARS-CoV-2 Nucleoprotein (346-360)
- SARS-CoV-2 Nucleoprotein (351-365)
- SARS-CoV-2 Nucleoprotein (353-370)
- SARS-CoV-2 Nucleoprotein (356-370)
- SARS-CoV-2 Nucleoprotein (51-65)
- SARS-CoV-2 Nucleoprotein (61-75)
- SARS-CoV-2 Nucleoprotein (86-100)
- SARS-CoV-2 Nucleoprotein 1 (56-70)
- SARS-CoV-2 Nucleoprotein 2 (326-340)
- SARS-CoV-2 ORF7a-10 (69-86)
- SARS-CoV-2 Spike (1192-1200)
- SARS-CoV-2 Spike (1196-1205)
- SARS-CoV-2 Spike (1197-1206)
- SARS-CoV-2 Spike (236-250)
- SARS-CoV-2 Spike (757-765)
- SARS-CoV-2 Spike (781-795)
- SARS-CoV-2 Spike (975-983)
- SARS-CoV-2 Spike (975-989)
- SARS-CoV-2 Spike (991-1000)
- SARS-CoV-2 Spike (996-1004)
- SARS-CoV-2 Spike (999-1007)
- SARS-inhibitor 4
- Scrambled LL-37 peptide
- Secretin (rat)
- Sendai Virus nucleoprotein (324-332)
- T22 peptide
- Temporin A
- Temporin L
- Tritrpticin
- VP4 (449-454) Nora virus
- VP4 (93-101) Nora virus
- [5-FAM]-LL-37
- [Cys]-Influenza Virus Nucleoprotein (311 – 325)
- Biotin Labeled
- BCL-6 corepressor Human (BCOR) (498-514) C-terminal Biotin
- beta-Amyloid (1-10) Biotin
- beta-Amyloid (1-11) Biotin
- beta-Amyloid (1-12) Biotin
- beta-Amyloid (1-13) Biotin
- beta-Amyloid (1-14) Biotin
- Biotin Apolipoprotein A-I (APOA1)(86-101)
- Biotin BRC4 (1517-1551)
- Biotin gliadin-derived peptide
- Biotin HER-2 substrate peptide
- Biotin phosphorylated CDK7 (157-169)
- Biotin phosphorylated JAK1 substrate peptide
- Biotin SBP1
- Biotin SBP2
- Biotin Steroid Receptor Coactivator-1 (SRC-1) (676-700)
- Biotin Substance P
- Biotin TAT (48-60)
- Biotin-aMp3
- biotin-aMptD
- Biotin-Axltide Peptide substrate
- Biotin-beta-Amyloid (1-15) human
- Biotin-Desmoglein-3 DSG3 (50-79)
- Biotin-GLP-1 (7-36)
- Biotin-Histone H3 (14-34) K23Me3
- Biotin-Histone H3 (14-34) pT22 K23Me3
- Biotin-Influenza A NP (147-155) (H-2Kd)
- Biotin-Jak2 substrate
- Biotin-LPETAG N-terminal Sortagging
- Biotin-LPETGG N-terminal Sortagging
- Biotin-Nrf2 (69-84)
- Biotin-PEG2-Claudin-3
- Biotin-PEG2-Claudin-6
- Biotin-PEG2-Claudin-9
- Biotin-TAT (47-57)
- Biotin-β Amyloid (1-42) Human
- Biotinylated L57
- C-Terminal Sortagging-AAA-[Lys(Biotin]
- C-Terminal Sortagging-[Lys(Biotin]
- Galanin (2-13)-Biotin
- Galanin (3-13)-Biotin
- Histone H2A (1-20)-GGK(Biotin)
- Histone H3 (1-20)
- Histone H3 (1-20)-[S]-Biotin
- Histone H3 (1-22) K4Me3-Biotin
- Histone H3 (1-22) K9Me1-Biotin
- Histone H3 (10-29)-Biotin
- Histone H3 (20-39)-Biotin
- MHC class II antigen E alpha (52-68)-Biotin
- Pyroglutamyl beta-Amyloid (4-14) Biotin
- [Biotin]-GLP-1
- Cancer Peptides
- A6 peptide
- AD01 N-terminal Q
- ARF peptide
- Bak BH3
- Bevacizumab Light chain
- Bid BH3 Peptide
- BIM 187
- Bim BH3, Peptide IV
- Braftide
- C7
- CooP
- Cyclo(CLLFVY)
- D-Arg PEP
- dodecapeptide AR71
- DOTA-(Tyr3)-octreotate Acetate Salt
- FAM49B (190-198) Mouse
- FFW
- FREG peptide
- GRGD-acid
- HIF-1 α (556-574)
- Infliximab Heavy chain (46-60)
- PEN-FFW
- Proapoptotic Peptide KLA
- RAGE antagonist peptide
- Rituximab Light chain (41-55)
- RKOpep
- XL 13m
- YSA acid
- [Tyr0]-Apelin-13
- Cell Penetrating Peptides - CPP
- (Arg)9 peptide
- (RFR)4XB
- 3xFlag [DYKDDDDK]
- Acetyl-Arg9
- Angiopep 2
- Antennapedia peptide
- Antennapedia peptide amide
- Antennapedia peptide Arg
- Azhx-Penetratin
- C105Y
- CPP9
- Cys(Npys)-Antennapedia peptide amide
- DYKDDDDK FLAG peptide
- Flexible Glycine Linker (3xGGGGS)
- L17E
- MART-1 (26-35)
- MHV EP™
- N3-His tag
- Penetratin peptide
- Pep – 1 – Chariot
- PR9
- RAG8
- Secretoneurin Mouse Rat
- T peptide
- TAT (47-57) peptide
- TfR targeting sequence
- [5-FAM]-(RXR)4XB
- Click Peptides
- COVID-19 Peptides
- ACE2 – Angiotensin-Converting enzyme 2 – peptide library
- Biotin-SARS-CoV-2 Spike RBD 319-335 peptide
- Biotin-SARS-CoV-2 Spike RBD 336-347 peptide
- Biotin-SARS-CoV-2 Spike RBD 348-357 peptide
- Biotin-SARS-CoV-2 Spike RBD 352-365 peptide
- Biotin-SARS-CoV-2 Spike RBD 371-394 peptide
- Biotin-SARS-CoV-2 Spike RBD 395-430 peptide
- Biotin-SARS-CoV-2 Spike RBD 513-520 peptide
- Biotin-SARS-CoV-2 Spike RBD 523-541 peptide
- Biotin-SARS-CoV-2 Spike RBM 438-458 peptide
- Biotin-SARS-CoV-2 Spike RBM 450-473 peptide
- Biotin-SARS-CoV-2 Spike RBM 480-496 peptide
- Biotin-SARS-CoV-2 Spike RBM 500-509 peptide
- CoV Main Protease (Mpro) Substrate
- SARS CoV-2 Spike (S) protein – Peptide library
- SARS-CoV 3C-like protease (3CLpro) substrate (C-terminal KK-acid)
- SARS-CoV-2 Membrane protein (141-158)
- SARS-CoV-2 Membrane protein (172-188)
- SARS-CoV-2 NSP7 (26-40)
- SARS-CoV-2 Nucleocapsid (N) protein – Peptide library
- SARS-CoV-2 Nucleoprotein 2 (261-275)
- SARS-CoV-2 ORF3a (26-40)
- SARS-CoV-2 Spike RBD 319-335 peptide
- SARS-CoV-2 Spike RBD 336-347 peptide
- SARS-CoV-2 Spike RBD 348-357 peptide
- SARS-CoV-2 Spike RBD 352-365 peptide
- SARS-CoV-2 Spike RBD 371-394 peptide
- SARS-CoV-2 Spike RBD 395-430 peptide
- SARS-CoV-2 Spike RBD 513-520 peptide
- SARS-CoV-2 Spike RBD 523-541 peptide
- SARS-CoV-2 Spike RBM 438-458 peptide
- SARS-CoV-2 Spike RBM 450-473 peptide
- SARS-CoV-2 Spike RBM 480-496 peptide
- SARS-CoV-2 Spike RBM 500-509 peptide
- Spike Protein (SARS-CoV-2) Peptide Pool
- UCI-1
- Variants package of SARS CoV-2 Spike (S) protein mutation – Peptide library
- Fluorescent Peptides
- ™PRSS4 (199-207) fluorogenic peptide
- (Cbz-LGR)2-[Rh110]
- (N-Cbz-Nle-KRR)2-[Rh110]
- (PFR)2-[Rh110]
- (Tos-GFHR)2-[Rh110]
- (Tos-GPR)2-[Rh110]
- (Tos-YASR)2-[Rh110]
- 5-FAM-Fz7-21
- AAA-C(AF647) C-Terminal Sortagging
- Ac-Arg-Gly-Lys(Ac)-AMC
- Ac-GPLD-[Rh110]-[D-Pro]
- Ac-RGK-[AMC]
- Ac-RLR-[AMC] Proteasome Substrate
- Ac-RLR-[Rh110]-[D-Pro]
- Acetyl-Alpha-2-antiplasmin-[AF680]
- Acetyl-Histone H4 (1-21) K5Ac, K8Ac, K12Ac, K16Ac-GG-[Lys(5-FAM)]
- Acetyl-Histone H4 (1-23) K16Ac-GG-[Lys(5-FAM)]
- Acetyl-Histone H4 (1-23)-GG-[Lys(5-FAM)]
- acfTAT
- ACTH (1-24) -[5-FAM]
- AF488 6xHis Tag
- AF488 Insulin
- AF488 Plectin-1-targeting peptide
- AF647 RGD peptide
- C-terminal Sortagging-[Cys(AF488)]
- C-terminal Sortagging-[Cys(AF680)] acid
- C-terminal Sortagging-[Cys(AF680)] amide
- C-terminal Sortagging-[Cys(Sulfocyanine3)]
- C-terminal Sortagging-[Cys(Sulfocyanine5)]
- C-terminal Sortagging-[Cys(Sulfocyanine7)]
- Cathepsin G FRET substrate [5-FAM]/[6-TAMRA]
- Cys(BDP630/650)-Galanin (1-30) Human
- DNA damage-binding protein 2 (DDB2)-[Cys(AF647)]-amide
- ERAAP substrate Ep
- Exendin-4 [Lys(AF647)]
- FLAG tag (Cy3B)
- Fluorescein HLA-A*02:01 HBV core (18-27)
- Formyl-MLF-[Cys(AF488)]
- GGG-C(AF647) C-Terminal Sortagging
- GGG-[K(5-TAMRA)] C-terminal Sortagging
- Ghrelin-[Cys(AF647)] Human
- GLP-1 (7-36) [Cys(Sulfocyanine5)]
- Glucagon (1-29)-[Cys(Cy5)]
- Glucagon (1-29)-[Lys(AF647)]
- GRGD-[Cys(AF647)]
- H-Met-Gly-Pro-[AMC].HCl
- HCV NS3 protease FRET substrate
- Histone H3 (1-15) K4Me3, K9Ac, pS10
- Histone H3 (1-20) K4Me2-GG-[Lys(5-FAM)]
- Histone H3 (1-20) K4Me3, K9Ac, pS10-GG-[Cys(Aurora™ Fluor 647)]
- Histone H3 (1-20) K4Me3, K9Ac, pS10-GG-[Lys(5-FAM)]
- Histone H3 (1-20) K4Me3, K9Ac-GG-[Lys(5-FAM)]
- Histone H3 (1-20) K4Me3, pS10-GG-[Lys(5-FAM)]
- Histone H3 (1-20) K4Me3-GG-[Cys(Aurora™ Fluor 647)]
- Histone H3 (1-20) K4Me3-GG-[Lys(5-FAM)]
- Histone H3 (1-20) pT3, K4Me3-GG-[Lys(5-FAM)]
- Histone H3 (1-20)-GG-[Cys(Aurora™ Fluor 647)]
- Histone H3 (1-20)-GG-[Lys(5-FAM)]
- Histone H3-GG-[Cys(5-FAM)]-amide
- Insulysin FRET substrate [Mca]/[Dnp]
- KHLF-[AMC]
- LasB FRET substrate
- Leu-AFC.HCl
- Melittin [Cy5]
- PFR-[AMC]
- Plasmin-[AMC] substrate
- Ser3-n-octanoyl Ghrelin-[Cys(AF647)] Human
- SMAC/DIABLO [Lys(5-FAM)]
- SMAC/DIABLO-[Cys(AF647)]
- SMRT peptide-(Cys[AF633])
- Suc-LLVY-[AMC]
- Suc-LLVY-[Rh110]-[D-Pro]
- [β-Ala]-[Lys(5-TAMRA)]-acid
- [β-Ala]-[Lys(AMCA)]-acid
- [5-FAM] Antennapedia peptide amide
- [5-FAM] EGFR/kinKDR peptide substrate
- [5-FAM] Histone H3 (1-14) K4Me3
- [5-FAM] Kemptide
- [5-FAM]-(KFF)3K
- [5-FAM]-(RFR)4XB
- [5-FAM]-Arg9
- [5-FAM]-beta-Amyloid (1-15) Human
- [5-FAM]-C7
- [5-FAM]-CADY
- [5-FAM]-Collagen alpha-1(I)-(5-TAMRA)
- [5-FAM]-CRAMP (6-39)
- [5-FAM]-EB1
- [5-FAM]-ERKtide
- [5-FAM]-Galanin (1-30) Human
- [5-FAM]-GLP-1
- [5-FAM]-GLP-1 (7-36)
- [5-FAM]-IFN-γ receptor (pTyr) peptide
- [5-FAM]-M918
- [5-FAM]-MAP
- [5-FAM]-MPG∆NLS
- [5-FAM]-PR9
- [5-FAM]-PTH (1-34)
- [5-FAM]-pVec
- [5-FAM]-RGD peptide
- [5-FAM]-RKOpep
- [5-FAM]-RPKPQQFFGLM-NH2
- [5-FAM]-SRC Substrate Peptide
- [5-FAM]-TAT
- [5-FAM]-TAT (47-57) amide
- [5-FAM]-Tp10
- [5-FAM]-Tyr-Ahx-Ser-Asp-Lys-Pro-acid
- [5-FAM]-Val
- [5-FAM]-VGB4
- [5-FAM]/[Lys(Dabcyl)]-CoV Main Protease (Mpro) Substrate
- [5-FAM]/[Lys(Dnp)]-SARS-CoV-2 S1/S2
- [5-TAMRA] Galanin, Human
- [5-TAMRA]-ATIA agonist [sar1, Ile4, Ile8]
- [5-TAMRA]-Galanin (1-30) Human
- [5-TAMRA]-LPETAG N-terminal Sortagging
- [5-TAMRA]-LPETGG N-terminal Sortagging
- [5-TAMRA]/[Lys(BHQ-2)] Ubiquitin
- [5-TAMRA]/[Lys(BHQ-2)]-CoV Main Protease (Mpro) Substrate
- [6-FAM]-Arg8
- [Atto655]-LifeAct (Abp140 1-17)
- [Aurora™ Fluor 647]-RGD peptide
- [Azhx]-[Lys(Mca)]-P11-8
- [BDP630/650]3-halphaCGRP (calcitonin gene-related peptide)
- [Cy3B]-LifeAct (Abp140 1-17)
- [Cys(AF488)]-Penetratin
- [Cys(AF647)]-Jak2/3 substrate
- [DABCYL]/[Glu(EDANS)] SARS-CoV-2 3C-like protease (3CLpro) substrate
- [FITC]-Ahx-(KKEEE)3K carrier peptide
- [FITC]-C7
- [FITC]-pCREB (127-134) substrate
- [MCA]/[Lys(Dnp)]-CoV Main Protease (Mpro) Substrate
- [Rhodamine Green]-LifeAct (Abp140 1-17)
- [Sulfo-Cyanine3]-LifeAct (Abp140 1-17)
- [Sulfo-Cyanine5]-Val-Pro-Valp(OPh)2
- [TAMRA]-beta-Amyloid (1-15) Human
- GPCR Modulators
- Growth Factors and Cytokines
- Boc-Val-Pro-Arg-AMC
- CHKtide
- CSK substrate
- EGFR (963-975)
- EGFR/kinKDR peptide substrate
- HSP70/DnaK Substrate Peptide
- IRS-1 substrate
- LHRH
- N-methylated ERAP1substrate
- Phosphorylated CHKtide
- Phosphorylated Sakamototide
- PKA Substrate
- Renin substrate
- Sakamototide
- SAMS peptide
- Somatostatin 14 (human, rat, mouse, pig, chicken, frog)
- SRC Substrate Peptide
- Hematology Related Peptides
- Histone Peptides
- Acetyl-Histone H4 (1-21)
- H4 peptide (16-23)
- Histone H1 derived peptide
- Histone H2A (1-20)
- Histone H2A (78-86)
- Histone H3 (1-18)
- Histone H3 (1-20) K4Me3
- Histone H3 (1-20) K4Me3, K9Ac, pS10-GG-Biotin
- Histone H3 (1-21)
- Histone H3 (1-21) K4ac
- Histone H3 (1-21) K4Me2
- Histone H3 (1-21) K4Me3
- Histone H3 (1-21) K9Me2
- Histone H3 (1-22)
- Histone H3 (1-8)
- Histone H3 (20-36) K27Me3
- Histone H3 (22-30) K27Me3
- Histone H3 (30-41) K36Me2
- Histone H3 (32-38) K36Me2
- Histone H3 (32-47)
- Histone H3-GGC-amide
- Histone H3.2 (1-44)
- Histone H3.3 (1-44)
- Histone H4 (1-21)
- Histone H4 (1-21) R3Me1
- Histone H4 (1-21) R3Me2
- Histone H4 (1-23)
- Osteogenic Growth Peptide (OGP)
- SETD8 Peptide
- Hormones
- ACTH (7-39) human
- Alexamorelin
- Alpha mating factor – WHWLQLKPGQPMY
- ANP (1-23)
- ANP (13-26)
- ANP (7-20)
- ANP (7-23)
- ANP (9-22)
- ANP 1-28 Human
- BNP-32 human
- Bradykinin
- Calcitonin, human – Agonist of the calcitonin receptor CTR
- Calcitonin, Rat
- Calcitonin, Salmon
- CCL2 (MCP-1)
- Exendin 3 (9-39) amide
- Exendin 4 (4-39)
- Exendin 4 – Potent GLP-1R agonist
- Gastrin Releasing Peptide, human
- GIP (1-42)-[C] human
- GIP (Pro 3)
- GIP, human
- GLP-1 (1-37)
- GLP-1 (7-36) amide
- GLP-1 (9-36) amide
- Glucagon (3-29)
- Glucagon like-peptide-2 (GLP-2)
- GPS1573
- GRP (14-27), human, porcine
- h-Chemerin-9 (149-157)
- Insulin beta Chain Peptide (15 – 23)
- Isotocin
- Liraglutide
- Motilin (1-10)
- Motilin (1-12)
- Motilin (human, porcine)
- Oxytocin
- Pro-BNP (47-76)
- Protirelin – Thyrotropin-releasing hormone (TRH) (CAS: 24305-27-9)
- PTH (1-13) Human
- PTH (1-34) human
- PTH (13-34) Human
- RANTES (CCL5)
- [Glu2]-TRH peptide (CAS: 85541-78-2)
- Immunology - Antigens/Epitotes/Pools/Librairies
- 2-Furoyl-LIGRL-amide
- 4-Fluorobenzoyl-A20FMDV2
- A*02:01/Human Survivin (96-104) peptide – LTLGEFLKL
- A*02:01/Human Survivin/SurA2.M (LMLGEFLKL) peptide
- AAV8 capsid protein
- Acetyl-HIV-1 reverse transcriptase (A2-YI9)
- Acetyl-TGF-beta 2-LAPbeta (259- 269)
- AF12198
- AH1 Sequence (6-14)
- AIP-I
- AIP-II
- AIP-III
- AIP-IV
- Allergen Ara h 1 (560-572)
- alpha-Gliadin (31 – 43)
- Annexin A1 (2-12)
- Ara h 2 (147-155) peanut Allergen
- Ara h 3 (278-284) peanut Allergen
- Ara h 6 (120-131) peanut Allergen
- Ara h1 (555-577) peanut Allergen
- AYPGFK Protease-Activated Receptor-4 (PAR-4)
- B-peptide
- BAM (8-22)
- BAT3 (340-347), human
- BDC2.5 mimotope 1040-51
- Biotin-FluM1 (58-66) peptide
- Biotin-MAGE-A1 (278-286) peptide
- Biotin-MAGE-A2 (157-166) peptide
- Biotin-NY-ESO-1 (157-165) C165V peptide
- Biotin-Ova (323-339) peptide
- Biotin-PADRE peptide AKFVAAWTLKAAA
- C5A
- CD20 (188-196) peptide – SLFLGILSV
- CEF (HLA Class I Control) Peptide Pool
- CEFT Control Peptide Pool (HLA Class I Control)
- Cilengitide (Linear)
- CMV IE-1 (213-225)
- CMV pp65 (113-121) peptide – VYALPLKML
- CMV pp65 (120-129) peptide – MLNIPSINV
- CMV pp65 (415-429) (HLA-B7)
- CMV pp65 (485-500)
- CMV pp65 (495-503) (HLA-A2)
- CMV pp65 (511-525)(HLA-B44)
- Compstatin
- Cyclo(-RGDyK)
- Cyclo(RGDfK)
- EBV BMLF1 (280-288) (HLA-A2)
- EBV BMLF1 (280-288) peptide – GLCTLVAML
- EBV BNRF1 (1238-1252)
- EBV BRLF1 (134-142) (HLA-A11)
- EBV BRLF1 (148-156) (HLA-A3)
- EBV BRLF1 (28-37) (HLA-A24)
- EBV BZLF1 (190-197) (HLA-B8)
- EBV BZLF1 (40-48) (HLA-E)
- EBV EBNA3A (158-166) (HLA-B8)
- EBV EBNA3A (325-333) (HLA-B8)
- EBV EBNA3A (379-387) (HLA-B7)
- EBV EBNA3A (458-466) (HLA-B35)
- EBV EBNA3A (603-611) (HLA-A3)
- EBV EBNA3B (416-424) (HLA-A11)
- EBV EBNA3C (258-266) (HLA-B27)
- EBV EBNA3C (281-290) (HLA-B44)
- ELA Elabela/Toddler-32
- Fibrinogen, b43-63
- Fibrinopeptide
- Flu-HA-B (306-318) MHC II DRB1*01:01
- FluM1 (58-66) peptide – GILGFVFTL
- GHK tripeptide
- gp100 (25-33) epitope – KVPRNQDWL
- gp100 (280-288) A288V HLA-A*0201 antigen peptide – YLEPGPVTV
- GP33 (1-9)
- gp96-II
- Haemagglutinin (HA) peptide YPYDVPDYA
- HCV NS5B (2594-2602) peptide – ALYDVVTKL
- Her-2/neu (85-94) peptide – LIAHNQVRQV
- HIV-1 p17 Gag (77-85) peptide – SLYNTVATL
- HIV-1 reverse transcriptase (A2-YI9)
- HLA-A*02:01 HBV core (18-27)
- HLA-A*02:01 NY-ESO-1 (157-165)
- HLA-A*02:01 Polymerase (400-408)
- HLA-A*02:01 Polymerase (417-425)
- HLA-DRB1*1501 peptide
- HPV E7 protein (49-57)
- HPV16 E7 (86-93)
- HS1 protein (160-168)
- hsBCL9CT-24
- Human PD – L1 inhibitor V
- I-A(g7) BDC2.5 mimotope
- IDR 1002
- IFNB1 (118-132) Human
- IL-33 peptide
- Influenza A HA (306-318)
- Influenza A NP (265-273) (HLA-A3)
- Influenza A NP (380-388) (HLA-B8)
- Influenza A NP (383-391) (HLA-B27)
- Influenza A NP (44-52) (HLA-A1)
- Influenza A NP (91-99) (HLA-A68)
- Influenza A PB1 (591-599) (HLA-A1)
- Interleukin-27 subunit beta (22-30)
- KD20 peptide
- MAGE-A p248V9 peptide – YLEYRQVPV
- MAGE-A p248V9 scrambled (RQYVELPYV)
- MAGE-A1 (278-286) peptide – KVLEYVIKV
- MAGE-A1 (278-286) scrambled (ELIVKVYKV)
- MAGE-A2 (157-166) peptide – YLQLVFGIEV
- MAGE-A2 (157-166) scrambled (VLVYFQEIGL)
- MAGE-A3 (112-120) peptide – KVAELVHFL
- MAGE-A3 (FLWGPRALV)
- MAGE-A3 (IMPKAGLLI)
- MBP-B MHC II DRB1*15:01 (84-102)
- Melan-A (26-35) A27L peptide – ELAGIGILTV
- Melan-A (26-35) peptide – EAAGIGILTV – CAS: 156251-01-3
- Melan-A (26-35) scrambled (AIEIAGGLTV)
- MHC binding peptides prediction
- MOG (34-56) Human amide
- MOG (35-51) cit46 human
- MOG (35-55) amide Mouse, Rat
- MUC1 (12-20) peptide – LLLLTVLTV
- Myoglobin 137-148 MHC II DRB1*03:01
- Nangibotide
- NY-ESO-1 (123-137) DRB1*04:01 peptide – LKEFTVSGNILTIRL
- NY-ESO-1 (157-165) C165V peptide – SLLMWITQV
- NY-ESO-1 (157-165) C165V scrambled (MSILWQLVT)
- NY-ESO-1 (157-165) peptide – SLLMWITQC
- ORF65 (131-140) [Murid herpesvirus 4]
- OVA (250-264)
- OVA (251-264)
- OVA (323 – 339) amide
- Ova (323-339) peptide – ISQAVHAAHAEINEAGR
- OVA 257 264 peptide – SIINFEKL
- OVA 257 264 peptide SIINFEKL – KLH conjugate
- OVA 257-264 scrambled (FILKSINE)
- OVA Peptides Pool
- Ovalbumin (324-338), chicken, quail
- Ovalbumin (324-340) acetyl/amide, chicken
- ovalbumin (371-382), chicken
- P17
- PADRE peptide – AKFVAAWTLKAAA
- Palmitoyl GHK tripeptide
- PD-1 (21-35)
- PD-1 (24-38)
- PD-1 (27-41)
- Peptide antigen and epitope catalog
- Peptide Tyrosinase (Asp371) – HLA-A*0201 (YMDGTMSQV)
- Pip6a
- PLP (139-151)
- PMX 205
- PMX 53
- PRAME (100-108) HLA-A*0201
- Restricted PADRE peptide- ak(Cha)VAAWTLKAAa-Ahx-C
- RS09/Toll Like Receptor TLR4 agonist – APPHALS – CAS 1449566-36-2
- S2-16
- Se™elanotide
- SMAP-18
- SPA4 Peptide
- survivin (baculoviral IAP repeat-containing protein 5) (21-28)
- SYFPEITHI – MHC binding peptide
- TET 830 modified/T-helper epitope from tetanus toxoid – AQYIKANSKFIGITEL
- TET 830/Tetanus Toxin (830-844) peptide – QYIKANSKFIGITEL
- Tetanus Toxin P2 (830 – 844)
- TetTox-B (830-843) MHC II DRB1*07:01
- TKD (450-463)
- Tregitope 084
- Tregitope 289
- TRP-2 Peptide (180-188) – SVYDFFVWL
- Uty HY Peptide (246-254) Mouse
- V5 peptide
- Vitronectin (367-378)
- [Ala144]-PLP (139-151)
- Ion Channels and Transporters
- (Dap22)-ShK
- 8xHis-ProTx-II
- Aah-II
- Acetyl-Claudin-3
- Acetyl-Claudin-6
- Acetyl-Claudin-9
- ACT1
- ADWX-1
- Agitoxin-2
- alpha-cobratoxin
- AmmTx3
- Apamin
- APETx2
- Apolipoprotein A-I (APOA1)(86-101)
- Apolipoprotein KV domain (67 – 77)
- ATTO488-Charybdotoxin
- ATTO488-ProTx-I
- ATTO488-ProTx-II
- ATX-II
- BDS-I
- BeKm-1
- Biotin-ProTx-I
- BmP02
- C-Peptide (57-87) human
- Charybdotoxin
- Chlorotoxin
- Conantokin-G
- Crotamine
- Cy3-Crotamine
- Cy5-Huwentoxin-IV
- Cy5-ProTx-I
- Cy5-ProTx-II
- D-GsMTx4
- Dc1a
- Echistatin α1 isoform
- GAP26
- GaTx2
- GrTx1
- GsAF-1
- GsAF-2
- GsMTx4
- Guangxitoxin-1E
- Hainantoxin-III
- Hainantoxin-IV
- Hm1a
- HSA (55-66)
- HsTx1
- Huwentoxin-I
- Huwentoxin-IV
- Huwentoxin-XVI
- Iberiotoxin
- Jingzhaotoxin-34
- Jingzhaotoxin-III
- Kaliotoxin-1
- Latartoxin-1a
- Leiurotoxin-1
- Leiurotoxin-1 Dab7
- Lys-conopressin-G
- Mambalgin-1
- Margatoxin
- Maurocalcine
- Maurotoxin
- Melittin
- MitTx (MitTx-α + MitTx-β)
- Morphiceptin
- MT7 – Muscarinic Toxin 7
- NMB-1
- Obtustatin
- OD1
- Panx-1 mimetic inhibitory peptide
- Phlotoxin-1
- Phrixotoxin-2
- Phrixotoxin-3
- PNC 27
- ProTx-I
- ProTx-II
- ProTx-II-Biotin
- ProTx-III
- Psalmotoxin-1 (PcTx1)
- Purotoxin-1
- Rho-Conotoxin-TIA
- ShK – Stichodactyla toxin
- Stromatoxin-1 (ScTx1)
- Tamapin
- TAMRA-Charybdotoxin
- TAMRA-ShK
- Tertiapin Q
- Tf2 scorpion toxin
- U2-sicaritoxin-Li1a
- Waglerin-1
- Waglerin-1-FAM
- α-Conotoxin BuIA
- α-Conotoxin PIA
- α-conotoxin-GI
- α-conotoxin-GID
- α-conotoxin-IMI
- α-conotoxin-MI
- α-conotoxin-PeIA
- αC-Conotoxin-PrXA
- β-Pompilidotoxin
- µ-conotoxin KIIIA
- µ-conotoxin-CnIIIC
- µ-conotoxin-GIIIB
- μ-conotoxin-PIIIA
- µO conotoxin MrVIB
- ρ-Da1a (AdTx1)
- ω-agatoxin-IVA
- ω-Conotoxin-GVIA
- ω-Conotoxin-MVIIA
- ω-Conotoxin-MVIIC
- ω-Conotoxin-SO3
- ω-Hexatoxin-Hv1a
- ω-Tbo-IT1
- Multiple sclerosis peptides
- Biotin-Mouse MOG (35-55) peptide
- Experimental Autoimmune Encephalomyelitis KIT
- Human MOG Peptides Pool
- MBP (1-11) human: Ac-ASQKRPSQRHG CAS 106128-98-7
- MBP (84-97) – VVHFFKNIVTPRTP
- MBP (85–99) – EKPKVEAYKAAAAPA
- MOG (183-191) – FVIVPVLGP
- MOG (35-55), human peptide
- MOG (91-108) peptide – SDEGGYTCFFRDHSYQEE
- MOG (92-106) peptide – DEGGYTCFFRDHSYQ
- MOG (97-108) peptide- TCFFRDHSYQEE
- Mouse MOG (35-55) peptide
- PLP (139-151) peptide – HSLGKWLGHPDKF – [CAS 122018-58-0]
- PLP (178-191): NTWTTCQSIAFPSK mouse, rat
- Myelin Basic Protein (MBP) Peptides
- Neuroscience Peptides
- (Ala11, D-Leu15)-Orexin B human
- (Arg8) Vasopressin (AVP)
- (Arg8) Vasotocin
- (D-Pro7)-Angiotensin I/II (1-7)
- (Des-octanoyl)-Ghrelin Human
- Acein
- Acetyl-Alpha-synuclein (1-13)
- Acetylated alpha-synuclein (1-7) amide
- ACTH (1-10) Human
- ACTH (1-17) Human
- ACTH (1-24) Human
- ACTH (1-39) Human
- ACTH (11-24)
- ACTH (15-24) Cys
- ACTH (18-39) Human
- ACTH (7-38) Human
- ACTH (7-39) Cys
- Alpha-Casozepine
- alpha-MSH
- Alpha-synuclein (1-13)
- Amylin (1-37) Human
- Amyloid beta peptides
- Angiotensin (Human, 1-7)
- Angiotensin I
- Angiotensin II Antipeptide
- Angiotensin III
- Angiotensin IV (3-8)
- Apelin (65-76), human
- Apelin-17 (human, bovine)
- Apolipoprotein E fragment (133-149) – COG133 : LRVRLASHLRKLRKRLL (CAS : 514200-66-9)
- Biotin-ACTH (1-39) Human
- CCK octapeptide Cholecystokinin (26-33)
- CE dipeptide
- CMX-8933
- CRF human, rat
- Duck liver-derived peptide 2
- Duck liver-derived peptide 3
- Duck liver-derived peptide 4
- EC dipeptide
- Echinotocin neuropeptide
- FMRFamide peptide
- Galanin (1-13)
- Galanin (1-15) Porcine, Rat
- Galanin (1-17) Porcine
- Galanin (13-20) Mouse
- Galanin (2-12) acid
- Galanin (2-13)
- Galanin (2-13) acid
- Galanin (2-30) acid
- Galanin (3-13)
- Galanin Human
- Galanin Mouse, Rat
- Galantide
- Ghrelin Human
- Ghrelin Rat, Mouse
- GP dipeptide
- GRP (18-27) (human, porcine, canine)
- Hyp-Gly dipeptide
- IFNB1 (118-132) Human deimmunised
- Kinetensin
- Kisspeptin 10 human
- Kisspeptin 14 human
- KLPGF peptide
- L57
- Leptin (116-130) Mouse
- Leptin (93 – 105) Human
- LRRKtide
- MiniAp-4 peptide
- Motilin (1-16)
- Myhc-α 334-352
- Neurokinin A (Substance K)
- Neurokinin B (human, porcine)
- Neuromedin U 25
- Neuropeptide NPSF
- Neuropeptide RFRP-1 (81-92)
- Neuropeptide RFRP-2 (101-112)
- Neuropeptide RFRP-3 (124-131)
- Neuropeptide S human
- Neuropeptide S mouse
- Neuropeptide S rat
- Neuropeptide Y (3-36) Human,Rat
- Neurotensin
- Nociceptin
- NX 210
- Orexin A (monkey)
- Ovalbumin (154-159)
- Ovotransferrin (328-332)
- OXA (17-33)
- Oxidised Alpha-synuclein (1-13)
- Oxytocin (free acid)
- Pep63
- Peptide5
- Polybia-MPII
- SARS-CoV Peptide Antigen negative control
- Spexin
- Substance P
- Thyroglobulin (Tg-FSP)
- Thyroglobulin (Tg-VIF)
- VIP (1-12)
- VIP (6-28)
- [5-FAM]-Galanin (2-30)-[Cys] (Human)
- [Cys]-Galanin (1-30) Human
- [Glp6,Pro9] Substance P (6-11)/Septide
- [Pyr]-Apelin-13
- α-CGRP (mouse, rat)
- Other Categories
- 123B9
- 14-3-3 zeta/delta (28-41)
- 1D,6L-Lanthionine vasopressin
- 3x DYKDDDDK peptide
- a-Gliadin (229-246)
- AD01
- Adrenomedullin (22-52)
- AF10847
- alpha-gliadin (58-73)
- Angiotensin II
- APYTFGQGTK peptide
- Autocamtide-2
- Beclin-1
- Biotin-DAG Peptide
- BMAP-28
- BMF
- BNP-32, porcine
- Bombesin – Potent natural agonist of the mammalian receptor GRPR
- C-telopeptide
- C5aR2 agonist
- cAC 253
- Caloxin 1C2
- Cardiac Targeting Peptide CTP
- CBL (167-180) Light
- CBL (598-612) Light
- CBL-B (22-37) Light
- CBL-B (239-247) Light
- CCK Octapeptide sulfated
- Cecropin-B
- Cellulose synthase 7
- CIGB 300
- Cilengitide
- CNP (1-22), Human, Porcine
- CREB327/active transcription factor CREB-A (113-126) Biotinyl, human
- CREB327/active transcription factor CREB-A (113-126) [5-FAM] amide, Human
- CREB327/active transcription factor CREB-A (113-126), human
- Cysteine Peptide for DPRA tests
- D11-FxxLF Coactivator peptide
- DAG peptide
- Dinitrophenyl ERAP1 peptide
- DYKDDDDK peptide
- Dystrophin (2690-2700)
- Dystrophin (2765-2777)
- Dystrophin (396-405)
- Dystrophin (50-61)
- Dystrophin, DMD
- EHD1
- elf18
- Enfuvirtide (T-20)
- Farnesylated a-factor
- Fas blocking peptide
- FEFEFKFK
- Fibrinogen (377-395) Human
- Flagellin 22 (flg22)
- Formyl-MIFL-acid
- Formyl-Δ-toxin (1-26)
- FSY tripeptide
- Fz7-21
- GALA Peptide
- Ganglioside GM1-binding peptides p3
- Gastrin-1 Rat
- GG-[AMC]
- GIP (1-30) Human amide
- GPRPK pentapeptide
- GQPR tetrapeptide
- GRGDS peptide
- GS dipeptide
- GSS tripeptide
- Heart-homing peptide
- Herceptide
- HiBiT tag
- HIV-1 Rev (34-50)
- HPV16 E6 pep11**m
- HSA (549-558)
- Human Influenza Hemagglutinin (HA) Tag (YPYDVPDYA)
- humanized anti-Tac (HAT) binding peptide
- Hyp3-Bradykinin
- Ig heavy chain V-III region Light
- Ig heavy chain variable region Light
- IGRP Catalytic Subunit-related Protein (206-214)
- Insulin A Chain (A12-21)
- Insulin B (9-23)
- Integral membrane TGN38A (350-361) acetyl, mouse
- Integrin-binding cell adhesive peptide
- Intracellular Sigma Peptide
- JAG-1 (188-204)
- JAG-1, scrambled
- Jelleine 1
- Jelleine 2
- Jelleine 3
- Jelleine 4
- Kallikrein-2 inhibitor
- KLHY-[AMC]
- KR-12-a5 (6-DL)
- KRREILSRRPSYR-acid
- Lasioglossin-III
- LDVP peptide
- Leuprolide Acetate
- LLO (91 – 99)
- Locustatachykinin I
- LP2
- Lys-Glu dipeptide
- Lysine peptide for DPRA tests
- M12 muscle-homing peptide
- M2-Influenza
- MAGEA4 (230-239) Light
- MART-1 (27-35) (human)
- MART-1 Fragment
- Max-1 peptide
- Mouse-ESC-derived cardiomyocyte-targeting peptide
- Mucin 10 (153 – 165), EA2
- MyHC (614-629)
- N-L-Glutamyl-L-Lysine
- Natalizumab (LC46-58)
- Natalizumab LC46-58 KGN deimmunised
- Natalizumab LC46-58 KSN deimmunised
- nef peptide [Human immunodeficiency virus type 1] (73-82) acetyl/amide
- nef protein (75-82) [Human immunodeficiency virus 1]
- nef protein fragment (Acetyl/amide) [Human immunodeficiency virus 1]
- Neuromedin U 8
- Nictide
- Octreotide
- P007 (RXR)4XB
- P12
- P12 amide
- P1A antigen
- Palmitoyl GQPR tetrapeptide
- Palmitoyl KTTKS pentapeptide
- PEN (Mouse)
- PEN, Human
- PEN, Rat
- Pepstatin A
- Pepstatin A Biotin
- Peripheral Myelin Protein P0 (180-199)
- polyalanine peptide (pALA)
- Polybia-MPI
- Polyproline-13
- pp89 phosphoprotein fragment [Mouse cytomegalovirus 1]
- Proinsulin 90-104
- Prolactin-releasing peptide (PrRP20)
- Prostate-specific membrane antigen PSM (35-40), human
- PTD-p65-P1 Peptide
- PUMA BH3
- R5
- Relaxin 3 B1-22R amide
- RGD peptide
- RGD Peptide GRGDSPK
- Rhodopsin Epitope Tag
- S413-PV-[Cys(Npys)]
- SARS-CoV-2 Spike (411-420)
- SARS-CoV-2 Spike (976-984)
- SBCleaner – Peptide decontamination
- Semaglutide Heavy
- SG dipeptide
- SGS tripeptide
- Shepherdin (79 – 87)
- Sialokinins I
- Sifuvirtude
- Skeletal muscle-targeted peptide MSP
- SmBiT
- SMRT peptide
- SOD1 (147-153) human
- Spexin 2 (53-70) Human, Mouse, Rat
- SRC-1 (676-700)
- SSG tripeptide
- Stabilized avi tag peptide
- Steroid Receptor Coactivator-1 (SRC-1) (686-700)
- Suc-LLVY-acid
- Syntide 2
- T-9 peptide
- TAT-GSK’364A
- Teduglutide (GLP2 2G)
- Temporin SHF
- Tet-20
- Tetanus Toxin (1084-1099)
- Tetanus Toxin (1174-1189)
- Tetanus Toxin P30 (947-967)
- Thrombin Receptor Antagonist
- TNF-alpha (1-26), human
- TP10
- TPL-2tide
- Transportan
- TRAP-6 peptide
- Triptorelin acetate
- Truncated flagellin 22 (flg22)
- Tumstatin (69-88)
- Ub4ix
- UBA3 (59-72) peptide
- Urumin
- V5 epitope tag
- Vasculotide
- VGB4
- VIP (guinea pig)
- Visperas1pY
- Visperas2pY
- Xenin
- YSA amide
- [5-FAM]-DAG peptide
- [Azhx]-ANP (Human)
- [Cys] citrullinated alpha enolase
- [Cys]-Exendin 4
- [Nle12] a-factor
- [Tyr]-CNP22, Human
- εV1-2
- PNA
- Protein-Protein Interactions
- Stable Isotope Labeled (SIL) peptides catalog
- ADALQAGASQFETSAAK* – SIL Infliximab signature peptide
- APYTFGQGTK* – SIL Adalimumab internal standard
- ASGYTFTSYNMHWVK* – SIL Rituximab signature peptide quantifier
- ASQSIGTNIHWYQQR* – SIL Cetuximab signature peptide qualifier
- DYAMTWVR* – SIL Dupilumab signature peptide qualifier
- GLEWIGAIYPGNGDTSYNQK* – SIL Rituximab signature peptide qualifier
- Heavy Angiotensin II
- Heavy calcitonin peptide
- LEWIGEIDPSESNTNYNQK* – SIL Vedolozumab signature peptide
- LSITIRPR* – SIL Dupilumab signature peptide quantifier
- NYLAWYQQKPGK* – SIL Adalimumab signature peptide quantifier
- QAPGQGLEWMGDINTR* – SIL Emicizumab signature peptide qualifier
- SGGSIYNEEFQDR* – SIL Emicizumab signature peptide quantifier
- SINSATHYAESVK* – SIL Infliximab signature peptide quantifier
- SLEWIGAIDPYYGGTSYNQK* – SIL Dinutuximab signature peptide qualifier
- SSSTAYMHLK* – SIL Dinutuximab signature peptide quantifier
- YASESISGIPSR* – SIL Cetuximab signature peptide quantifier
- YASESMSGIPSR* – SIL Infliximab signature peptide qualifier
- Stapled Peptides
- TAT Conjugated Peptides
- Cys-TAT(48-60)
- dfTAT
- fTAT
- gp91 ds-TAT
- SMAC/DIABLO -TAT (48-60)-[Lys]
- TAT (48-57)
- TAT (48-59) amide
- TAT (48-60) amide
- TAT – GluR23Y
- TAT 2-4
- TAT protein (28-35) [Simian immunodeficiency virus]
- TAT-AKAP79 (326-336) amide
- TAT-AKAP79 (326-336) scrambled
- TAT-AKAP79 (326-336) scrambled amide
- TAT-Beclin 1
- TAT-Beclin Scrambled
- TAT-CHN9 (C-ter)
- TAT-CN21
- TAT-NR2B (C-ter)
- TAT-Pro ADAM10 (709-729)
- TAT-TRPV1 (736-745)








