Abaecin - Antimicrobial Peptide
Abaecin is a proline-rich cationic antimicrobial peptide (PrAMP) and was isolated from Apis mellifera. Abaecin is a 34 amino acid peptide including 10 prolines positioned uniformly which prevents the α-helical conformation.
Technical specification
![]() |
Sequence : YVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY-OH |
![]() |
MW : 3 878.54 Da (C187H270N48OS43) |
![]() |
Purity : > 95% |
![]() |
Counter-Ion : TFA Salts (see option TFA removal) |
![]() |
Delivery format : Freeze dried in propylene 2mL microtubes |
![]() |
Other names : 123997-18-2 |
![]() |
Peptide Solubility Guideline |
![]() |
Bulk peptide quantities available |
Price
| Product catalog | Size | Price € HT | Price $ USD |
| SB025-1MG | 1 mg | 127 | 158 |
| SB025-5*1MG | 5 mg | 440 | 550 |
References
1- Kim,D.S.,Kim,S.W.,Song,J.M. et al. BMC Biotechnol (2019)
A new prokaryotic expression vector for the expression of antimicrobial peptide abaecin using SUMO fusion tag
BACKGROUND:
Despite the growing demand for antimicrobial peptides (AMPs) for clinical use as an alternative approach against antibiotic-resistant bacteria,the manufacture of AMPs relies on expensive,small-scale chemical methods. The small ubiquitin-related modifier (SUMO) tag is industrially practical for increasing the yield of recombinant proteins by increasing solubility and preventing degradation in expression systems.
RESULTS:
A new vector system,pKSEC1,was designed to produce AMPs,which can work in prokaryotic systems such as Escherichia coli and plant chloroplasts. 6xHis was tagged to SUMO for purification of SUMO-fused AMPs. Abaecin,a 34-aa-long antimicrobial peptide from honeybees,was expressed in a fusion form to 6xHis-SUMO in a new vector system to evaluate the prokaryotic expression platform of the antimicrobial peptides. The fusion sequences were codon-optimized in three different combinations and expressed in E. coli. The combination of the native SUMO sequence with codon-optimized abaecin showed the highest expression level among the three combinations,and most of the expressed fusion proteins were detected in soluble fractions. Cleavage of the SUMO tag by sumoase produced a 29-aa-long abaecin derivative with a C-terminal deletion. However,this abaecin derivative still retained the binding sequence for its target protein,DnaK. Antibacterial activity of the 29-aa long abaecin was tested against Bacillus subtilis alone or in combination with cecropin B. The combined treatment of the abaecin derivative and cecropin B showed bacteriolytic activity 2 to 3 times greater than that of abaecin alone.
CONCLUSIONS:
Using a SUMO-tag with an appropriate codon-optimization strategy could be an approach for the production of antimicrobial peptides in E.coli without affecting the viability of the host cell.
KEYWORDS:
Abaecin; Antimicrobial peptide; Codon optimization; Escherichia coli; Small ubiquitin-related modifier (SUMO)
2- Luiz,D.P.,Almeida,J.F.,Goulart,L.R. et al. Microb Cell Fact 16,76 (2017)
Heterologous expression of abaecin peptide from Apis mellifera in Pichia pastoris
BACKGROUND:
Antimicrobial peptides (AMPs) are the first line of host immune defense against pathogens. Among AMPs from the honeybee Apis mellifera,abaecin is a major broad-spectrum antibacterial proline-enriched cationic peptide.
RESULTS:
For heterologous expression of abaecin in Pichia pastoris,we designed an ORF with HisTag,and the codon usage was optimized. The gene was chemically synthetized and cloned in the pUC57 vector. The new ORF was sub-cloned in the pPIC9 expression vector and transformed into P. pastoris. After selection of positive clones,the expression was induced by methanol. The supernatant was analyzed at different times to determine the optimal time for the recombinant peptide expression. As a proof-of-concept,Escherichia coli was co-incubated with the recombinant peptide to verify its antimicrobial potential.
DISCUSSION:
Briefly,the recombinant Abaecin (rAbaecin) has efficiently decreased E. coli growth (P < 0.05) through an in vitro assay,and may be considered as a novel therapeutic agent that may complement other conventional antibiotic therapies.
KEYWORDS:
Abaecin; Apis mellifera; Heterologous expression; Pichia pastoris; Proline-rich antimicrobial peptide
- Amyloid Peptides
- Acetyl-ccbeta
- beta-Amyloid (1-11) Human
- beta-Amyloid (1-12) Human
- beta-Amyloid (1-14)
- beta-Amyloid (1-15) human
- beta-Amyloid (1-16) Human
- beta-Amyloid (1-17) Human
- beta-Amyloid (1-28) human
- beta-Amyloid (1-40) Human
- beta-Amyloid (1-6)-GGC Human
- beta-Amyloid (10-20) Human
- beta-Amyloid (11-20) Human
- Beta-Amyloid (12-20)
- beta-Amyloid (35-25)
- RNase A (77-82) Amyloidogenic peptide
- SEN 304
- Tau (195-209) Light
- Tau Peptide (45-73)
- Antimicrobial Peptides - AMP
- Abaecin
- Acetyl-Adhesin
- AcrAP1
- AcrAP1a
- AcrAP2
- AcrAP2a
- Alloferon 1
- Alloferon 2
- Alyteserin-1a
- Alyteserin-1b
- Alyteserin-1c
- Alyteserin-1d
- Alyteserin-2a
- Alyteserin-2b
- Alyteserin-2c
- Alyteserin-2Mb
- Anoplin
- Apidaecin IB
- B8R (20 – 27)
- Balteatide
- BMAP-18
- BMAP-18 (truncated)
- Buforin II
- Cecropin A
- Codesane
- CRAMP (1-39)
- CRAMP (6-39)
- CRAMP-18
- Cyclic L27-11
- Cycloviolacin O2 peptide
- Epinecidin-1
- FdM
- Feleucin-B01
- Gag (18-26) [Human immunodeficiency virus type 1] acetyl/amide
- Gag peptide [Simian immunodeficiency virus]
- Gag protein (181-189) acetyl/amide [Simian immunodeficiency virus]
- GLK-19
- hBD-2 peptide – human Beta Defensin 2
- HEL46-61
- Hepcidin-25 (LEAP-1 peptide)
- Histatin-5
- Histatin-8
- Hp1404
- Human Lysozyme (107-115)
- IDR-1
- Indolicidin
- Influenza Virus Nucleoprotein (311 – 325)
- KDAMP
- LL-13-37
- LL-17-29
- LL-17-32
- LL-37 amide
- LL-37 fragment (24-29)
- LL-37 fragment (30-34)
- LL-37 fragment (30-37)
- LL-37 peptide (CAP-18)
- Macropin 1
- Macropin 2
- Magainin II
- Magainin-1
- MALT1 substrate
- Mastoparan
- Mastoparan peptide
- mBD3 peptide – mouse Beta Defensin 3
- MP196
- N-formylated PSMalpha2
- N-formylated PSMalpha3
- P2-Hp-1935
- PA protein (Influenza A virus)
- PAF19
- PAF26
- Pantinin-1
- Pantinin-2
- Pantinin-3
- Pap12-6
- Parasin I
- Pseudin-2
- Sapecin B
- SARS-CoV-2 NSP13 (221-235)
- SARS-CoV-2 NSP13 (226-240)
- SARS-CoV-2 NSP13 (231-245)
- SARS-CoV-2 NSP13 (236-250)
- SARS-CoV-2 NSP13 (241-255)
- SARS-CoV-2 NSP13 (246-260)
- SARS-CoV-2 NSP13 (321-335)
- SARS-CoV-2 NSP13 (326-340)
- SARS-CoV-2 NSP13 (336-350)
- SARS-CoV-2 NSP13 (421-435)
- SARS-CoV-2 NSP13 (426-440)
- SARS-CoV-2 NSP13 (466-480)
- SARS-CoV-2 NSP13 (476-490)
- SARS-CoV-2 NSP13 (551-565)
- SARS-CoV-2 NSP13 (556-570)
- SARS-CoV-2 NSP13 (576-590)
- SARS-CoV-2 NSP13 (581-595)
- SARS-CoV-2 NSP7 (1-15)
- SARS-CoV-2 NSP7 (21-35)
- SARS-CoV-2 NSP7 (31-45)
- SARS-CoV-2 NSP7 (46-60)
- SARS-CoV-2 NSP7 (51-65)
- SARS-CoV-2 NSP7 (6-20)
- SARS-CoV-2 Nucleoprotein (1-17)
- SARS-CoV-2 Nucleoprotein (104-121)
- SARS-CoV-2 Nucleoprotein (126-140)
- SARS-CoV-2 Nucleoprotein (266-280)
- SARS-CoV-2 Nucleoprotein (271-285)
- SARS-CoV-2 Nucleoprotein (321-335)
- SARS-CoV-2 Nucleoprotein (331-345)
- SARS-CoV-2 Nucleoprotein (341-355)
- SARS-CoV-2 Nucleoprotein (346-360)
- SARS-CoV-2 Nucleoprotein (351-365)
- SARS-CoV-2 Nucleoprotein (353-370)
- SARS-CoV-2 Nucleoprotein (356-370)
- SARS-CoV-2 Nucleoprotein (51-65)
- SARS-CoV-2 Nucleoprotein (61-75)
- SARS-CoV-2 Nucleoprotein (86-100)
- SARS-CoV-2 Nucleoprotein 1 (56-70)
- SARS-CoV-2 Nucleoprotein 2 (326-340)
- SARS-CoV-2 ORF7a-10 (69-86)
- SARS-CoV-2 Spike (1192-1200)
- SARS-CoV-2 Spike (1196-1205)
- SARS-CoV-2 Spike (1197-1206)
- SARS-CoV-2 Spike (236-250)
- SARS-CoV-2 Spike (757-765)
- SARS-CoV-2 Spike (781-795)
- SARS-CoV-2 Spike (975-983)
- SARS-CoV-2 Spike (975-989)
- SARS-CoV-2 Spike (991-1000)
- SARS-CoV-2 Spike (996-1004)
- SARS-CoV-2 Spike (999-1007)
- SARS-inhibitor 4
- Scrambled LL-37 peptide
- Secretin (rat)
- Sendai Virus nucleoprotein (324-332)
- T22 peptide
- Temporin A
- Temporin L
- Tritrpticin
- VP4 (449-454) Nora virus
- VP4 (93-101) Nora virus
- [5-FAM]-LL-37
- [Cys]-Influenza Virus Nucleoprotein (311 – 325)
- Biotin Labeled
- BCL-6 corepressor Human (BCOR) (498-514) C-terminal Biotin
- beta-Amyloid (1-10) Biotin
- beta-Amyloid (1-11) Biotin
- beta-Amyloid (1-12) Biotin
- beta-Amyloid (1-13) Biotin
- beta-Amyloid (1-14) Biotin
- Biotin Apolipoprotein A-I (APOA1)(86-101)
- Biotin BRC4 (1517-1551)
- Biotin gliadin-derived peptide
- Biotin HER-2 substrate peptide
- Biotin phosphorylated CDK7 (157-169)
- Biotin phosphorylated JAK1 substrate peptide
- Biotin SBP1
- Biotin SBP2
- Biotin Steroid Receptor Coactivator-1 (SRC-1) (676-700)
- Biotin Substance P
- Biotin TAT (48-60)
- Biotin-aMp3
- biotin-aMptD
- Biotin-Axltide Peptide substrate
- Biotin-beta-Amyloid (1-15) human
- Biotin-Desmoglein-3 DSG3 (50-79)
- Biotin-GLP-1 (7-36)
- Biotin-Histone H3 (14-34) K23Me3
- Biotin-Histone H3 (14-34) pT22 K23Me3
- Biotin-Influenza A NP (147-155) (H-2Kd)
- Biotin-Jak2 substrate
- Biotin-LPETAG N-terminal Sortagging
- Biotin-LPETGG N-terminal Sortagging
- Biotin-Nrf2 (69-84)
- Biotin-PEG2-Claudin-3
- Biotin-PEG2-Claudin-6
- Biotin-PEG2-Claudin-9
- Biotin-TAT (47-57)
- Biotin-β Amyloid (1-42) Human
- Biotinylated L57
- C-Terminal Sortagging-AAA-[Lys(Biotin]
- C-Terminal Sortagging-[Lys(Biotin]
- Galanin (2-13)-Biotin
- Galanin (3-13)-Biotin
- Histone H2A (1-20)-GGK(Biotin)
- Histone H3 (1-20)
- Histone H3 (1-20)-[S]-Biotin
- Histone H3 (1-22) K4Me3-Biotin
- Histone H3 (1-22) K9Me1-Biotin
- Histone H3 (10-29)-Biotin
- Histone H3 (20-39)-Biotin
- MHC class II antigen E alpha (52-68)-Biotin
- Pyroglutamyl beta-Amyloid (4-14) Biotin
- [Biotin]-GLP-1
- Cancer Peptides
- A6 peptide
- AD01 N-terminal Q
- ARF peptide
- Bak BH3
- Bevacizumab Light chain
- Bid BH3 Peptide
- BIM 187
- Bim BH3, Peptide IV
- Braftide
- C7
- CooP
- Cyclo(CLLFVY)
- D-Arg PEP
- dodecapeptide AR71
- DOTA-(Tyr3)-octreotate Acetate Salt
- FAM49B (190-198) Mouse
- FFW
- FREG peptide
- GRGD-acid
- HIF-1 α (556-574)
- Infliximab Heavy chain (46-60)
- PEN-FFW
- Proapoptotic Peptide KLA
- RAGE antagonist peptide
- Rituximab Light chain (41-55)
- RKOpep
- XL 13m
- YSA acid
- [Tyr0]-Apelin-13
- Cell Penetrating Peptides - CPP
- (Arg)9 peptide
- (RFR)4XB
- 3xFlag [DYKDDDDK]
- Acetyl-Arg9
- Angiopep 2
- Antennapedia peptide
- Antennapedia peptide amide
- Antennapedia peptide Arg
- Azhx-Penetratin
- C105Y
- CPP9
- Cys(Npys)-Antennapedia peptide amide
- DYKDDDDK FLAG peptide
- Flexible Glycine Linker (3xGGGGS)
- L17E
- MART-1 (26-35)
- MHV EP™
- N3-His tag
- Penetratin peptide
- Pep – 1 – Chariot
- PR9
- RAG8
- Secretoneurin Mouse Rat
- T peptide
- TAT (47-57) peptide
- TfR targeting sequence
- [5-FAM]-(RXR)4XB
- Click Peptides
- COVID-19 Peptides
- ACE2 – Angiotensin-Converting enzyme 2 – peptide library
- Biotin-SARS-CoV-2 Spike RBD 319-335 peptide
- Biotin-SARS-CoV-2 Spike RBD 336-347 peptide
- Biotin-SARS-CoV-2 Spike RBD 348-357 peptide
- Biotin-SARS-CoV-2 Spike RBD 352-365 peptide
- Biotin-SARS-CoV-2 Spike RBD 371-394 peptide
- Biotin-SARS-CoV-2 Spike RBD 395-430 peptide
- Biotin-SARS-CoV-2 Spike RBD 513-520 peptide
- Biotin-SARS-CoV-2 Spike RBD 523-541 peptide
- Biotin-SARS-CoV-2 Spike RBM 438-458 peptide
- Biotin-SARS-CoV-2 Spike RBM 450-473 peptide
- Biotin-SARS-CoV-2 Spike RBM 480-496 peptide
- Biotin-SARS-CoV-2 Spike RBM 500-509 peptide
- CoV Main Protease (Mpro) Substrate
- SARS CoV-2 Spike (S) protein – Peptide library
- SARS-CoV 3C-like protease (3CLpro) substrate (C-terminal KK-acid)
- SARS-CoV-2 Membrane protein (141-158)
- SARS-CoV-2 Membrane protein (172-188)
- SARS-CoV-2 NSP7 (26-40)
- SARS-CoV-2 Nucleocapsid (N) protein – Peptide library
- SARS-CoV-2 Nucleoprotein 2 (261-275)
- SARS-CoV-2 ORF3a (26-40)
- SARS-CoV-2 Spike RBD 319-335 peptide
- SARS-CoV-2 Spike RBD 336-347 peptide
- SARS-CoV-2 Spike RBD 348-357 peptide
- SARS-CoV-2 Spike RBD 352-365 peptide
- SARS-CoV-2 Spike RBD 371-394 peptide
- SARS-CoV-2 Spike RBD 395-430 peptide
- SARS-CoV-2 Spike RBD 513-520 peptide
- SARS-CoV-2 Spike RBD 523-541 peptide
- SARS-CoV-2 Spike RBM 438-458 peptide
- SARS-CoV-2 Spike RBM 450-473 peptide
- SARS-CoV-2 Spike RBM 480-496 peptide
- SARS-CoV-2 Spike RBM 500-509 peptide
- Spike Protein (SARS-CoV-2) Peptide Pool
- UCI-1
- Variants package of SARS CoV-2 Spike (S) protein mutation – Peptide library
- Fluorescent Peptides
- ™PRSS4 (199-207) fluorogenic peptide
- (Cbz-LGR)2-[Rh110]
- (N-Cbz-Nle-KRR)2-[Rh110]
- (PFR)2-[Rh110]
- (Tos-GFHR)2-[Rh110]
- (Tos-GPR)2-[Rh110]
- (Tos-YASR)2-[Rh110]
- 5-FAM-Fz7-21
- AAA-C(AF647) C-Terminal Sortagging
- Ac-Arg-Gly-Lys(Ac)-AMC
- Ac-GPLD-[Rh110]-[D-Pro]
- Ac-RGK-[AMC]
- Ac-RLR-[AMC] Proteasome Substrate
- Ac-RLR-[Rh110]-[D-Pro]
- Acetyl-Alpha-2-antiplasmin-[AF680]
- Acetyl-Histone H4 (1-21) K5Ac, K8Ac, K12Ac, K16Ac-GG-[Lys(5-FAM)]
- Acetyl-Histone H4 (1-23) K16Ac-GG-[Lys(5-FAM)]
- Acetyl-Histone H4 (1-23)-GG-[Lys(5-FAM)]
- acfTAT
- ACTH (1-24) -[5-FAM]
- AF488 6xHis Tag
- AF488 Insulin
- AF488 Plectin-1-targeting peptide
- AF647 RGD peptide
- C-terminal Sortagging-[Cys(AF488)]
- C-terminal Sortagging-[Cys(AF680)] acid
- C-terminal Sortagging-[Cys(AF680)] amide
- C-terminal Sortagging-[Cys(Sulfocyanine3)]
- C-terminal Sortagging-[Cys(Sulfocyanine5)]
- C-terminal Sortagging-[Cys(Sulfocyanine7)]
- Cathepsin G FRET substrate [5-FAM]/[6-TAMRA]
- Cys(BDP630/650)-Galanin (1-30) Human
- DNA damage-binding protein 2 (DDB2)-[Cys(AF647)]-amide
- ERAAP substrate Ep
- Exendin-4 [Lys(AF647)]
- FLAG tag (Cy3B)
- Fluorescein HLA-A*02:01 HBV core (18-27)
- Formyl-MLF-[Cys(AF488)]
- GGG-C(AF647) C-Terminal Sortagging
- GGG-[K(5-TAMRA)] C-terminal Sortagging
- Ghrelin-[Cys(AF647)] Human
- GLP-1 (7-36) [Cys(Sulfocyanine5)]
- Glucagon (1-29)-[Cys(Cy5)]
- Glucagon (1-29)-[Lys(AF647)]
- GRGD-[Cys(AF647)]
- H-Met-Gly-Pro-[AMC].HCl
- HCV NS3 protease FRET substrate
- Histone H3 (1-15) K4Me3, K9Ac, pS10
- Histone H3 (1-20) K4Me2-GG-[Lys(5-FAM)]
- Histone H3 (1-20) K4Me3, K9Ac, pS10-GG-[Cys(Aurora™ Fluor 647)]
- Histone H3 (1-20) K4Me3, K9Ac, pS10-GG-[Lys(5-FAM)]
- Histone H3 (1-20) K4Me3, K9Ac-GG-[Lys(5-FAM)]
- Histone H3 (1-20) K4Me3, pS10-GG-[Lys(5-FAM)]
- Histone H3 (1-20) K4Me3-GG-[Cys(Aurora™ Fluor 647)]
- Histone H3 (1-20) K4Me3-GG-[Lys(5-FAM)]
- Histone H3 (1-20) pT3, K4Me3-GG-[Lys(5-FAM)]
- Histone H3 (1-20)-GG-[Cys(Aurora™ Fluor 647)]
- Histone H3 (1-20)-GG-[Lys(5-FAM)]
- Histone H3-GG-[Cys(5-FAM)]-amide
- Insulysin FRET substrate [Mca]/[Dnp]
- KHLF-[AMC]
- LasB FRET substrate
- Leu-AFC.HCl
- Melittin [Cy5]
- PFR-[AMC]
- Plasmin-[AMC] substrate
- Ser3-n-octanoyl Ghrelin-[Cys(AF647)] Human
- SMAC/DIABLO [Lys(5-FAM)]
- SMAC/DIABLO-[Cys(AF647)]
- SMRT peptide-(Cys[AF633])
- Suc-LLVY-[AMC]
- Suc-LLVY-[Rh110]-[D-Pro]
- [β-Ala]-[Lys(5-TAMRA)]-acid
- [β-Ala]-[Lys(AMCA)]-acid
- [5-FAM] Antennapedia peptide amide
- [5-FAM] EGFR/kinKDR peptide substrate
- [5-FAM] Histone H3 (1-14) K4Me3
- [5-FAM] Kemptide
- [5-FAM]-(KFF)3K
- [5-FAM]-(RFR)4XB
- [5-FAM]-Arg9
- [5-FAM]-beta-Amyloid (1-15) Human
- [5-FAM]-C7
- [5-FAM]-CADY
- [5-FAM]-Collagen alpha-1(I)-(5-TAMRA)
- [5-FAM]-CRAMP (6-39)
- [5-FAM]-EB1
- [5-FAM]-ERKtide
- [5-FAM]-Galanin (1-30) Human
- [5-FAM]-GLP-1
- [5-FAM]-GLP-1 (7-36)
- [5-FAM]-IFN-γ receptor (pTyr) peptide
- [5-FAM]-M918
- [5-FAM]-MAP
- [5-FAM]-MPG∆NLS
- [5-FAM]-PR9
- [5-FAM]-PTH (1-34)
- [5-FAM]-pVec
- [5-FAM]-RGD peptide
- [5-FAM]-RKOpep
- [5-FAM]-RPKPQQFFGLM-NH2
- [5-FAM]-SRC Substrate Peptide
- [5-FAM]-TAT
- [5-FAM]-TAT (47-57) amide
- [5-FAM]-Tp10
- [5-FAM]-Tyr-Ahx-Ser-Asp-Lys-Pro-acid
- [5-FAM]-Val
- [5-FAM]-VGB4
- [5-FAM]/[Lys(Dabcyl)]-CoV Main Protease (Mpro) Substrate
- [5-FAM]/[Lys(Dnp)]-SARS-CoV-2 S1/S2
- [5-TAMRA] Galanin, Human
- [5-TAMRA]-ATIA agonist [sar1, Ile4, Ile8]
- [5-TAMRA]-Galanin (1-30) Human
- [5-TAMRA]-LPETAG N-terminal Sortagging
- [5-TAMRA]-LPETGG N-terminal Sortagging
- [5-TAMRA]/[Lys(BHQ-2)] Ubiquitin
- [5-TAMRA]/[Lys(BHQ-2)]-CoV Main Protease (Mpro) Substrate
- [6-FAM]-Arg8
- [Atto655]-LifeAct (Abp140 1-17)
- [Aurora™ Fluor 647]-RGD peptide
- [Azhx]-[Lys(Mca)]-P11-8
- [BDP630/650]3-halphaCGRP (calcitonin gene-related peptide)
- [Cy3B]-LifeAct (Abp140 1-17)
- [Cys(AF488)]-Penetratin
- [Cys(AF647)]-Jak2/3 substrate
- [DABCYL]/[Glu(EDANS)] SARS-CoV-2 3C-like protease (3CLpro) substrate
- [FITC]-Ahx-(KKEEE)3K carrier peptide
- [FITC]-C7
- [FITC]-pCREB (127-134) substrate
- [MCA]/[Lys(Dnp)]-CoV Main Protease (Mpro) Substrate
- [Rhodamine Green]-LifeAct (Abp140 1-17)
- [Sulfo-Cyanine3]-LifeAct (Abp140 1-17)
- [Sulfo-Cyanine5]-Val-Pro-Valp(OPh)2
- [TAMRA]-beta-Amyloid (1-15) Human
- GPCR Modulators
- Growth Factors and Cytokines
- Boc-Val-Pro-Arg-AMC
- CHKtide
- CSK substrate
- EGFR (963-975)
- EGFR/kinKDR peptide substrate
- HSP70/DnaK Substrate Peptide
- IRS-1 substrate
- LHRH
- N-methylated ERAP1substrate
- Phosphorylated CHKtide
- Phosphorylated Sakamototide
- PKA Substrate
- Renin substrate
- Sakamototide
- SAMS peptide
- Somatostatin 14 (human, rat, mouse, pig, chicken, frog)
- SRC Substrate Peptide
- Hematology Related Peptides
- Histone Peptides
- Acetyl-Histone H4 (1-21)
- H4 peptide (16-23)
- Histone H1 derived peptide
- Histone H2A (1-20)
- Histone H2A (78-86)
- Histone H3 (1-18)
- Histone H3 (1-20) K4Me3
- Histone H3 (1-20) K4Me3, K9Ac, pS10-GG-Biotin
- Histone H3 (1-21)
- Histone H3 (1-21) K4ac
- Histone H3 (1-21) K4Me2
- Histone H3 (1-21) K4Me3
- Histone H3 (1-21) K9Me2
- Histone H3 (1-22)
- Histone H3 (1-8)
- Histone H3 (20-36) K27Me3
- Histone H3 (22-30) K27Me3
- Histone H3 (30-41) K36Me2
- Histone H3 (32-38) K36Me2
- Histone H3 (32-47)
- Histone H3-GGC-amide
- Histone H3.2 (1-44)
- Histone H3.3 (1-44)
- Histone H4 (1-21)
- Histone H4 (1-21) R3Me1
- Histone H4 (1-21) R3Me2
- Histone H4 (1-23)
- Osteogenic Growth Peptide (OGP)
- SETD8 Peptide
- Hormones
- ACTH (7-39) human
- Alexamorelin
- Alpha mating factor – WHWLQLKPGQPMY
- ANP (1-23)
- ANP (13-26)
- ANP (7-20)
- ANP (7-23)
- ANP (9-22)
- ANP 1-28 Human
- BNP-32 human
- Bradykinin
- Calcitonin, human – Agonist of the calcitonin receptor CTR
- Calcitonin, Rat
- Calcitonin, Salmon
- CCL2 (MCP-1)
- Exendin 3 (9-39) amide
- Exendin 4 (4-39)
- Exendin 4 – Potent GLP-1R agonist
- Gastrin Releasing Peptide, human
- GIP (1-42)-[C] human
- GIP (Pro 3)
- GIP, human
- GLP-1 (1-37)
- GLP-1 (7-36) amide
- GLP-1 (9-36) amide
- Glucagon (3-29)
- Glucagon like-peptide-2 (GLP-2)
- GPS1573
- GRP (14-27), human, porcine
- h-Chemerin-9 (149-157)
- Insulin beta Chain Peptide (15 – 23)
- Isotocin
- Liraglutide
- Motilin (1-10)
- Motilin (1-12)
- Motilin (human, porcine)
- Oxytocin
- Pro-BNP (47-76)
- Protirelin – Thyrotropin-releasing hormone (TRH) (CAS: 24305-27-9)
- PTH (1-13) Human
- PTH (1-34) human
- PTH (13-34) Human
- RANTES (CCL5)
- [Glu2]-TRH peptide (CAS: 85541-78-2)
- Immunology - Antigens/Epitotes/Pools/Librairies
- 2-Furoyl-LIGRL-amide
- 4-Fluorobenzoyl-A20FMDV2
- A*02:01/Human Survivin (96-104) peptide – LTLGEFLKL
- A*02:01/Human Survivin/SurA2.M (LMLGEFLKL) peptide
- AAV8 capsid protein
- Acetyl-HIV-1 reverse transcriptase (A2-YI9)
- Acetyl-TGF-beta 2-LAPbeta (259- 269)
- AF12198
- AH1 Sequence (6-14)
- AIP-I
- AIP-II
- AIP-III
- AIP-IV
- Allergen Ara h 1 (560-572)
- alpha-Gliadin (31 – 43)
- Annexin A1 (2-12)
- Ara h 2 (147-155) peanut Allergen
- Ara h 3 (278-284) peanut Allergen
- Ara h 6 (120-131) peanut Allergen
- Ara h1 (555-577) peanut Allergen
- AYPGFK Protease-Activated Receptor-4 (PAR-4)
- B-peptide
- BAM (8-22)
- BAT3 (340-347), human
- BDC2.5 mimotope 1040-51
- Biotin-FluM1 (58-66) peptide
- Biotin-MAGE-A1 (278-286) peptide
- Biotin-MAGE-A2 (157-166) peptide
- Biotin-NY-ESO-1 (157-165) C165V peptide
- Biotin-Ova (323-339) peptide
- Biotin-PADRE peptide AKFVAAWTLKAAA
- C5A
- CD20 (188-196) peptide – SLFLGILSV
- CEF (HLA Class I Control) Peptide Pool
- CEFT Control Peptide Pool (HLA Class I Control)
- Cilengitide (Linear)
- CMV IE-1 (213-225)
- CMV pp65 (113-121) peptide – VYALPLKML
- CMV pp65 (120-129) peptide – MLNIPSINV
- CMV pp65 (415-429) (HLA-B7)
- CMV pp65 (485-500)
- CMV pp65 (495-503) (HLA-A2)
- CMV pp65 (511-525)(HLA-B44)
- Compstatin
- Cyclo(-RGDyK)
- Cyclo(RGDfK)
- EBV BMLF1 (280-288) (HLA-A2)
- EBV BMLF1 (280-288) peptide – GLCTLVAML
- EBV BNRF1 (1238-1252)
- EBV BRLF1 (134-142) (HLA-A11)
- EBV BRLF1 (148-156) (HLA-A3)
- EBV BRLF1 (28-37) (HLA-A24)
- EBV BZLF1 (190-197) (HLA-B8)
- EBV BZLF1 (40-48) (HLA-E)
- EBV EBNA3A (158-166) (HLA-B8)
- EBV EBNA3A (325-333) (HLA-B8)
- EBV EBNA3A (379-387) (HLA-B7)
- EBV EBNA3A (458-466) (HLA-B35)
- EBV EBNA3A (603-611) (HLA-A3)
- EBV EBNA3B (416-424) (HLA-A11)
- EBV EBNA3C (258-266) (HLA-B27)
- EBV EBNA3C (281-290) (HLA-B44)
- ELA Elabela/Toddler-32
- Fibrinogen, b43-63
- Fibrinopeptide
- Flu-HA-B (306-318) MHC II DRB1*01:01
- FluM1 (58-66) peptide – GILGFVFTL
- GHK tripeptide
- gp100 (25-33) epitope – KVPRNQDWL
- gp100 (280-288) A288V HLA-A*0201 antigen peptide – YLEPGPVTV
- GP33 (1-9)
- gp96-II
- Haemagglutinin (HA) peptide YPYDVPDYA
- HCV NS5B (2594-2602) peptide – ALYDVVTKL
- Her-2/neu (85-94) peptide – LIAHNQVRQV
- HIV-1 p17 Gag (77-85) peptide – SLYNTVATL
- HIV-1 reverse transcriptase (A2-YI9)
- HLA-A*02:01 HBV core (18-27)
- HLA-A*02:01 NY-ESO-1 (157-165)
- HLA-A*02:01 Polymerase (400-408)
- HLA-A*02:01 Polymerase (417-425)
- HLA-DRB1*1501 peptide
- HPV E7 protein (49-57)
- HPV16 E7 (86-93)
- HS1 protein (160-168)
- hsBCL9CT-24
- Human PD – L1 inhibitor V
- I-A(g7) BDC2.5 mimotope
- IDR 1002
- IFNB1 (118-132) Human
- IL-33 peptide
- Influenza A HA (306-318)
- Influenza A NP (265-273) (HLA-A3)
- Influenza A NP (380-388) (HLA-B8)
- Influenza A NP (383-391) (HLA-B27)
- Influenza A NP (44-52) (HLA-A1)
- Influenza A NP (91-99) (HLA-A68)
- Influenza A PB1 (591-599) (HLA-A1)
- Interleukin-27 subunit beta (22-30)
- KD20 peptide
- MAGE-A p248V9 peptide – YLEYRQVPV
- MAGE-A p248V9 scrambled (RQYVELPYV)
- MAGE-A1 (278-286) peptide – KVLEYVIKV
- MAGE-A1 (278-286) scrambled (ELIVKVYKV)
- MAGE-A2 (157-166) peptide – YLQLVFGIEV
- MAGE-A2 (157-166) scrambled (VLVYFQEIGL)
- MAGE-A3 (112-120) peptide – KVAELVHFL
- MAGE-A3 (FLWGPRALV)
- MAGE-A3 (IMPKAGLLI)
- MBP-B MHC II DRB1*15:01 (84-102)
- Melan-A (26-35) A27L peptide – ELAGIGILTV
- Melan-A (26-35) peptide – EAAGIGILTV – CAS: 156251-01-3
- Melan-A (26-35) scrambled (AIEIAGGLTV)
- MHC binding peptides prediction
- MOG (34-56) Human amide
- MOG (35-51) cit46 human
- MOG (35-55) amide Mouse, Rat
- MUC1 (12-20) peptide – LLLLTVLTV
- Myoglobin 137-148 MHC II DRB1*03:01
- Nangibotide
- NY-ESO-1 (123-137) DRB1*04:01 peptide – LKEFTVSGNILTIRL
- NY-ESO-1 (157-165) C165V peptide – SLLMWITQV
- NY-ESO-1 (157-165) C165V scrambled (MSILWQLVT)
- NY-ESO-1 (157-165) peptide – SLLMWITQC
- ORF65 (131-140) [Murid herpesvirus 4]
- OVA (250-264)
- OVA (251-264)
- OVA (323 – 339) amide
- Ova (323-339) peptide – ISQAVHAAHAEINEAGR
- OVA 257 264 peptide – SIINFEKL
- OVA 257 264 peptide SIINFEKL – KLH conjugate
- OVA 257-264 scrambled (FILKSINE)
- OVA Peptides Pool
- Ovalbumin (324-338), chicken, quail
- Ovalbumin (324-340) acetyl/amide, chicken
- ovalbumin (371-382), chicken
- P17
- PADRE peptide – AKFVAAWTLKAAA
- Palmitoyl GHK tripeptide
- PD-1 (21-35)
- PD-1 (24-38)
- PD-1 (27-41)
- Peptide antigen and epitope catalog
- Peptide Tyrosinase (Asp371) – HLA-A*0201 (YMDGTMSQV)
- Pip6a
- PLP (139-151)
- PMX 205
- PMX 53
- PRAME (100-108) HLA-A*0201
- Restricted PADRE peptide- ak(Cha)VAAWTLKAAa-Ahx-C
- RS09/Toll Like Receptor TLR4 agonist – APPHALS – CAS 1449566-36-2
- S2-16
- Se™elanotide
- SMAP-18
- SPA4 Peptide
- survivin (baculoviral IAP repeat-containing protein 5) (21-28)
- SYFPEITHI – MHC binding peptide
- TET 830 modified/T-helper epitope from tetanus toxoid – AQYIKANSKFIGITEL
- TET 830/Tetanus Toxin (830-844) peptide – QYIKANSKFIGITEL
- Tetanus Toxin P2 (830 – 844)
- TetTox-B (830-843) MHC II DRB1*07:01
- TKD (450-463)
- Tregitope 084
- Tregitope 289
- TRP-2 Peptide (180-188) – SVYDFFVWL
- Uty HY Peptide (246-254) Mouse
- V5 peptide
- Vitronectin (367-378)
- [Ala144]-PLP (139-151)
- Ion Channels and Transporters
- (Dap22)-ShK
- 8xHis-ProTx-II
- Aah-II
- Acetyl-Claudin-3
- Acetyl-Claudin-6
- Acetyl-Claudin-9
- ACT1
- ADWX-1
- Agitoxin-2
- alpha-cobratoxin
- AmmTx3
- Apamin
- APETx2
- Apolipoprotein A-I (APOA1)(86-101)
- Apolipoprotein KV domain (67 – 77)
- ATTO488-Charybdotoxin
- ATTO488-ProTx-I
- ATTO488-ProTx-II
- ATX-II
- BDS-I
- BeKm-1
- Biotin-ProTx-I
- BmP02
- C-Peptide (57-87) human
- Charybdotoxin
- Chlorotoxin
- Conantokin-G
- Crotamine
- Cy3-Crotamine
- Cy5-Huwentoxin-IV
- Cy5-ProTx-I
- Cy5-ProTx-II
- D-GsMTx4
- Dc1a
- Echistatin α1 isoform
- GAP26
- GaTx2
- GrTx1
- GsAF-1
- GsAF-2
- GsMTx4
- Guangxitoxin-1E
- Hainantoxin-III
- Hainantoxin-IV
- Hm1a
- HSA (55-66)
- HsTx1
- Huwentoxin-I
- Huwentoxin-IV
- Huwentoxin-XVI
- Iberiotoxin
- Jingzhaotoxin-34
- Jingzhaotoxin-III
- Kaliotoxin-1
- Latartoxin-1a
- Leiurotoxin-1
- Leiurotoxin-1 Dab7
- Lys-conopressin-G
- Mambalgin-1
- Margatoxin
- Maurocalcine
- Maurotoxin
- Melittin
- MitTx (MitTx-α + MitTx-β)
- Morphiceptin
- MT7 – Muscarinic Toxin 7
- NMB-1
- Obtustatin
- OD1
- Panx-1 mimetic inhibitory peptide
- Phlotoxin-1
- Phrixotoxin-2
- Phrixotoxin-3
- PNC 27
- ProTx-I
- ProTx-II
- ProTx-II-Biotin
- ProTx-III
- Psalmotoxin-1 (PcTx1)
- Purotoxin-1
- Rho-Conotoxin-TIA
- ShK – Stichodactyla toxin
- Stromatoxin-1 (ScTx1)
- Tamapin
- TAMRA-Charybdotoxin
- TAMRA-ShK
- Tertiapin Q
- Tf2 scorpion toxin
- U2-sicaritoxin-Li1a
- Waglerin-1
- Waglerin-1-FAM
- α-Conotoxin BuIA
- α-Conotoxin PIA
- α-conotoxin-GI
- α-conotoxin-GID
- α-conotoxin-IMI
- α-conotoxin-MI
- α-conotoxin-PeIA
- αC-Conotoxin-PrXA
- β-Pompilidotoxin
- µ-conotoxin KIIIA
- µ-conotoxin-CnIIIC
- µ-conotoxin-GIIIB
- μ-conotoxin-PIIIA
- µO conotoxin MrVIB
- ρ-Da1a (AdTx1)
- ω-agatoxin-IVA
- ω-Conotoxin-GVIA
- ω-Conotoxin-MVIIA
- ω-Conotoxin-MVIIC
- ω-Conotoxin-SO3
- ω-Hexatoxin-Hv1a
- ω-Tbo-IT1
- Multiple sclerosis peptides
- Biotin-Mouse MOG (35-55) peptide
- Experimental Autoimmune Encephalomyelitis KIT
- Human MOG Peptides Pool
- MBP (1-11) human: Ac-ASQKRPSQRHG CAS 106128-98-7
- MBP (84-97) – VVHFFKNIVTPRTP
- MBP (85–99) – EKPKVEAYKAAAAPA
- MOG (183-191) – FVIVPVLGP
- MOG (35-55), human peptide
- MOG (91-108) peptide – SDEGGYTCFFRDHSYQEE
- MOG (92-106) peptide – DEGGYTCFFRDHSYQ
- MOG (97-108) peptide- TCFFRDHSYQEE
- Mouse MOG (35-55) peptide
- PLP (139-151) peptide – HSLGKWLGHPDKF – [CAS 122018-58-0]
- PLP (178-191): NTWTTCQSIAFPSK mouse, rat
- Myelin Basic Protein (MBP) Peptides
- Neuroscience Peptides
- (Ala11, D-Leu15)-Orexin B human
- (Arg8) Vasopressin (AVP)
- (Arg8) Vasotocin
- (D-Pro7)-Angiotensin I/II (1-7)
- (Des-octanoyl)-Ghrelin Human
- Acein
- Acetyl-Alpha-synuclein (1-13)
- Acetylated alpha-synuclein (1-7) amide
- ACTH (1-10) Human
- ACTH (1-17) Human
- ACTH (1-24) Human
- ACTH (1-39) Human
- ACTH (11-24)
- ACTH (15-24) Cys
- ACTH (18-39) Human
- ACTH (7-38) Human
- ACTH (7-39) Cys
- Alpha-Casozepine
- alpha-MSH
- Alpha-synuclein (1-13)
- Amylin (1-37) Human
- Amyloid beta peptides
- Angiotensin (Human, 1-7)
- Angiotensin I
- Angiotensin II Antipeptide
- Angiotensin III
- Angiotensin IV (3-8)
- Apelin (65-76), human
- Apelin-17 (human, bovine)
- Apolipoprotein E fragment (133-149) – COG133 : LRVRLASHLRKLRKRLL (CAS : 514200-66-9)
- Biotin-ACTH (1-39) Human
- CCK octapeptide Cholecystokinin (26-33)
- CE dipeptide
- CMX-8933
- CRF human, rat
- Duck liver-derived peptide 2
- Duck liver-derived peptide 3
- Duck liver-derived peptide 4
- EC dipeptide
- Echinotocin neuropeptide
- FMRFamide peptide
- Galanin (1-13)
- Galanin (1-15) Porcine, Rat
- Galanin (1-17) Porcine
- Galanin (13-20) Mouse
- Galanin (2-12) acid
- Galanin (2-13)
- Galanin (2-13) acid
- Galanin (2-30) acid
- Galanin (3-13)
- Galanin Human
- Galanin Mouse, Rat
- Galantide
- Ghrelin Human
- Ghrelin Rat, Mouse
- GP dipeptide
- GRP (18-27) (human, porcine, canine)
- Hyp-Gly dipeptide
- IFNB1 (118-132) Human deimmunised
- Kinetensin
- Kisspeptin 10 human
- Kisspeptin 14 human
- KLPGF peptide
- L57
- Leptin (116-130) Mouse
- Leptin (93 – 105) Human
- LRRKtide
- MiniAp-4 peptide
- Motilin (1-16)
- Myhc-α 334-352
- Neurokinin A (Substance K)
- Neurokinin B (human, porcine)
- Neuromedin U 25
- Neuropeptide NPSF
- Neuropeptide RFRP-1 (81-92)
- Neuropeptide RFRP-2 (101-112)
- Neuropeptide RFRP-3 (124-131)
- Neuropeptide S human
- Neuropeptide S mouse
- Neuropeptide S rat
- Neuropeptide Y (3-36) Human,Rat
- Neurotensin
- Nociceptin
- NX 210
- Orexin A (monkey)
- Ovalbumin (154-159)
- Ovotransferrin (328-332)
- OXA (17-33)
- Oxidised Alpha-synuclein (1-13)
- Oxytocin (free acid)
- Pep63
- Peptide5
- Polybia-MPII
- SARS-CoV Peptide Antigen negative control
- Spexin
- Substance P
- Thyroglobulin (Tg-FSP)
- Thyroglobulin (Tg-VIF)
- VIP (1-12)
- VIP (6-28)
- [5-FAM]-Galanin (2-30)-[Cys] (Human)
- [Cys]-Galanin (1-30) Human
- [Glp6,Pro9] Substance P (6-11)/Septide
- [Pyr]-Apelin-13
- α-CGRP (mouse, rat)
- Other Categories
- 123B9
- 14-3-3 zeta/delta (28-41)
- 1D,6L-Lanthionine vasopressin
- 3x DYKDDDDK peptide
- a-Gliadin (229-246)
- AD01
- Adrenomedullin (22-52)
- AF10847
- alpha-gliadin (58-73)
- Angiotensin II
- APYTFGQGTK peptide
- Autocamtide-2
- Beclin-1
- Biotin-DAG Peptide
- BMAP-28
- BMF
- BNP-32, porcine
- Bombesin – Potent natural agonist of the mammalian receptor GRPR
- C-telopeptide
- C5aR2 agonist
- cAC 253
- Caloxin 1C2
- Cardiac Targeting Peptide CTP
- CBL (167-180) Light
- CBL (598-612) Light
- CBL-B (22-37) Light
- CBL-B (239-247) Light
- CCK Octapeptide sulfated
- Cecropin-B
- Cellulose synthase 7
- CIGB 300
- Cilengitide
- CNP (1-22), Human, Porcine
- CREB327/active transcription factor CREB-A (113-126) Biotinyl, human
- CREB327/active transcription factor CREB-A (113-126) [5-FAM] amide, Human
- CREB327/active transcription factor CREB-A (113-126), human
- Cysteine Peptide for DPRA tests
- D11-FxxLF Coactivator peptide
- DAG peptide
- Dinitrophenyl ERAP1 peptide
- DYKDDDDK peptide
- Dystrophin (2690-2700)
- Dystrophin (2765-2777)
- Dystrophin (396-405)
- Dystrophin (50-61)
- Dystrophin, DMD
- EHD1
- elf18
- Enfuvirtide (T-20)
- Farnesylated a-factor
- Fas blocking peptide
- FEFEFKFK
- Fibrinogen (377-395) Human
- Flagellin 22 (flg22)
- Formyl-MIFL-acid
- Formyl-Δ-toxin (1-26)
- FSY tripeptide
- Fz7-21
- GALA Peptide
- Ganglioside GM1-binding peptides p3
- Gastrin-1 Rat
- GG-[AMC]
- GIP (1-30) Human amide
- GPRPK pentapeptide
- GQPR tetrapeptide
- GRGDS peptide
- GS dipeptide
- GSS tripeptide
- Heart-homing peptide
- Herceptide
- HiBiT tag
- HIV-1 Rev (34-50)
- HPV16 E6 pep11**m
- HSA (549-558)
- Human Influenza Hemagglutinin (HA) Tag (YPYDVPDYA)
- humanized anti-Tac (HAT) binding peptide
- Hyp3-Bradykinin
- Ig heavy chain V-III region Light
- Ig heavy chain variable region Light
- IGRP Catalytic Subunit-related Protein (206-214)
- Insulin A Chain (A12-21)
- Insulin B (9-23)
- Integral membrane TGN38A (350-361) acetyl, mouse
- Integrin-binding cell adhesive peptide
- Intracellular Sigma Peptide
- JAG-1 (188-204)
- JAG-1, scrambled
- Jelleine 1
- Jelleine 2
- Jelleine 3
- Jelleine 4
- Kallikrein-2 inhibitor
- KLHY-[AMC]
- KR-12-a5 (6-DL)
- KRREILSRRPSYR-acid
- Lasioglossin-III
- LDVP peptide
- Leuprolide Acetate
- LLO (91 – 99)
- Locustatachykinin I
- LP2
- Lys-Glu dipeptide
- Lysine peptide for DPRA tests
- M12 muscle-homing peptide
- M2-Influenza
- MAGEA4 (230-239) Light
- MART-1 (27-35) (human)
- MART-1 Fragment
- Max-1 peptide
- Mouse-ESC-derived cardiomyocyte-targeting peptide
- Mucin 10 (153 – 165), EA2
- MyHC (614-629)
- N-L-Glutamyl-L-Lysine
- Natalizumab (LC46-58)
- Natalizumab LC46-58 KGN deimmunised
- Natalizumab LC46-58 KSN deimmunised
- nef peptide [Human immunodeficiency virus type 1] (73-82) acetyl/amide
- nef protein (75-82) [Human immunodeficiency virus 1]
- nef protein fragment (Acetyl/amide) [Human immunodeficiency virus 1]
- Neuromedin U 8
- Nictide
- Octreotide
- P007 (RXR)4XB
- P12
- P12 amide
- P1A antigen
- Palmitoyl GQPR tetrapeptide
- Palmitoyl KTTKS pentapeptide
- PEN (Mouse)
- PEN, Human
- PEN, Rat
- Pepstatin A
- Pepstatin A Biotin
- Peripheral Myelin Protein P0 (180-199)
- polyalanine peptide (pALA)
- Polybia-MPI
- Polyproline-13
- pp89 phosphoprotein fragment [Mouse cytomegalovirus 1]
- Proinsulin 90-104
- Prolactin-releasing peptide (PrRP20)
- Prostate-specific membrane antigen PSM (35-40), human
- PTD-p65-P1 Peptide
- PUMA BH3
- R5
- Relaxin 3 B1-22R amide
- RGD peptide
- RGD Peptide GRGDSPK
- Rhodopsin Epitope Tag
- S413-PV-[Cys(Npys)]
- SARS-CoV-2 Spike (411-420)
- SARS-CoV-2 Spike (976-984)
- SBCleaner – Peptide decontamination
- Semaglutide Heavy
- SG dipeptide
- SGS tripeptide
- Shepherdin (79 – 87)
- Sialokinins I
- Sifuvirtude
- Skeletal muscle-targeted peptide MSP
- SmBiT
- SMRT peptide
- SOD1 (147-153) human
- Spexin 2 (53-70) Human, Mouse, Rat
- SRC-1 (676-700)
- SSG tripeptide
- Stabilized avi tag peptide
- Steroid Receptor Coactivator-1 (SRC-1) (686-700)
- Suc-LLVY-acid
- Syntide 2
- T-9 peptide
- TAT-GSK’364A
- Teduglutide (GLP2 2G)
- Temporin SHF
- Tet-20
- Tetanus Toxin (1084-1099)
- Tetanus Toxin (1174-1189)
- Tetanus Toxin P30 (947-967)
- Thrombin Receptor Antagonist
- TNF-alpha (1-26), human
- TP10
- TPL-2tide
- Transportan
- TRAP-6 peptide
- Triptorelin acetate
- Truncated flagellin 22 (flg22)
- Tumstatin (69-88)
- Ub4ix
- UBA3 (59-72) peptide
- Urumin
- V5 epitope tag
- Vasculotide
- VGB4
- VIP (guinea pig)
- Visperas1pY
- Visperas2pY
- Xenin
- YSA amide
- [5-FAM]-DAG peptide
- [Azhx]-ANP (Human)
- [Cys] citrullinated alpha enolase
- [Cys]-Exendin 4
- [Nle12] a-factor
- [Tyr]-CNP22, Human
- εV1-2
- Protein-Protein Interactions
- Stable Isotope Labeled (SIL) peptides catalog
- ADALQAGASQFETSAAK* – SIL Infliximab signature peptide
- APYTFGQGTK* – SIL Adalimumab internal standard
- ASGYTFTSYNMHWVK* – SIL Rituximab signature peptide quantifier
- ASQSIGTNIHWYQQR* – SIL Cetuximab signature peptide qualifier
- DYAMTWVR* – SIL Dupilumab signature peptide qualifier
- GLEWIGAIYPGNGDTSYNQK* – SIL Rituximab signature peptide qualifier
- Heavy Angiotensin II
- Heavy calcitonin peptide
- LEWIGEIDPSESNTNYNQK* – SIL Vedolozumab signature peptide
- LSITIRPR* – SIL Dupilumab signature peptide quantifier
- NYLAWYQQKPGK* – SIL Adalimumab signature peptide quantifier
- QAPGQGLEWMGDINTR* – SIL Emicizumab signature peptide qualifier
- SGGSIYNEEFQDR* – SIL Emicizumab signature peptide quantifier
- SINSATHYAESVK* – SIL Infliximab signature peptide quantifier
- SLEWIGAIDPYYGGTSYNQK* – SIL Dinutuximab signature peptide qualifier
- SSSTAYMHLK* – SIL Dinutuximab signature peptide quantifier
- YASESISGIPSR* – SIL Cetuximab signature peptide quantifier
- YASESMSGIPSR* – SIL Infliximab signature peptide qualifier
- TAT Conjugated Peptides
- Cys-TAT(48-60)
- dfTAT
- fTAT
- gp91 ds-TAT
- SMAC/DIABLO -TAT (48-60)-[Lys]
- TAT (48-57)
- TAT (48-59) amide
- TAT (48-60) amide
- TAT – GluR23Y
- TAT 2-4
- TAT protein (28-35) [Simian immunodeficiency virus]
- TAT-AKAP79 (326-336) amide
- TAT-AKAP79 (326-336) scrambled
- TAT-AKAP79 (326-336) scrambled amide
- TAT-Beclin 1
- TAT-Beclin Scrambled
- TAT-CHN9 (C-ter)
- TAT-CN21
- TAT-NR2B (C-ter)
- TAT-Pro ADAM10 (709-729)
- TAT-TRPV1 (736-745)







